Product
Supplier
Encyclopedia
Inquiry
Home > Biochemical Engineering > Polypeptide > LL-37 for Sale > LL37 5mg 10+yeras API, Raw, Peptide factory supplier
LL37 5mg 10+yeras API, Raw, Peptide factory supplier buy - large image1
LL37 5mg 10+yeras API, Raw, Peptide factory supplier buy - image1
LL37 5mg 10+yeras API, Raw, Peptide factory supplier buy - image2
LL37 5mg 10+yeras API, Raw, Peptide factory supplier buy - image3
LL37 5mg 10+yeras API, Raw, Peptide factory supplier buy - image4
LL37 5mg 10+yeras API, Raw, Peptide factory supplier buy - image5
LL37 5mg 10+yeras API, Raw, Peptide factory supplier buy - image6

LL37 5mg 10+yeras API, Raw, Peptide factory supplier

Unit Price: Get Latest Price
CAS No.:

154947-66-7

Grade:

Pharmaceutical Grade

Content:

99%

Brand:

HAVHI

Packaging:

2mg*10vials

Price valid (until):

2026-06-21

Company Type:
Trader
Location:
China
Qualification:
Main Products:

Tirzepatide,Retatrutide,GHK-CU,NAD+,KPV,SS-31

  • Product Description

  • Seller Information

  • Description

    Description


     

        Product Detail   

     

    Luna

    whatsapp:+86 17732972158

    Email:luna@havhi.com


     
    Product Information
    •       

      Items Specifications
      Product  Name  Peptide
      Purity >99.0%
      Appearance White Lyophilized powder or others
      Reconstitution Required
      Storage After reconstitution store at 2°C - 8°C, well-closed containers
      MOQ 1 box
      Package 10 vials per box
      Payment term Alipay,Bitcoin,USDT,T/T, WU
      Delivery time Within 3 Working Days Payment
      Advantage Door to door,Clearance,100% safe delivery to your hands,By air receive them about 5-10days

      Shop In stock GHK-CU 89030-95-5 Copper tripeptide Door-to-door delivery, spot, high quality, high purity, free shipping-Detailed Image 6 Shop In stock Cosmetic Grade Copper Peptide Powder Ghk-Cu with Best Price and High Quality Ruilian-Detailed Image 7

        

      Shop MelanotanI High Quality Hot Sale 10mg Wholesale 99 purity-Detailed Image 1 Shop MelanotanI High Quality Hot Sale 10mg Wholesale 99 purity-Detailed Image 2 Shop MelanotanI High Quality Hot Sale 10mg Wholesale 99 purity-Detailed Image 3 Shop MelanotanI High Quality Hot Sale 10mg Wholesale 99 purity-Detailed Image 4 Shop MelanotanI High Quality Hot Sale 10mg Wholesale 99 purity-Detailed Image 5


      Shop PEG MGF 2mg 10 yeras API, Raw, Peptide factory supplier 99 purity-Detailed Image 1 Shop PEG MGF 2mg 10 yeras API, Raw, Peptide factory supplier 99 purity-Detailed Image 2 Shop PEG MGF 2mg 10 yeras API, Raw, Peptide factory supplier 99 purity-Detailed Image 3

      Shop PEG MGF 2mg 10 yeras API, Raw, Peptide factory supplier 99 purity-Detailed Image 4 Shop PEG MGF 2mg 10 yeras API, Raw, Peptide factory supplier 99 purity-Detailed Image 5 Shop PEG MGF 2mg 10 yeras API, Raw, Peptide factory supplier 99 purity-Detailed Image 6


    Key Specifications/ Special Features:



    best peptide powder peptide vials peptides 5mg 10mg 15mg 20mg 30mg good feedback with safe delivery


    Sema : 5mg 10mg 15mg 20mg 30mg

    Peptide Form: Lyophilized Powder

    Peptide Package: 10 Vials per box

    Peptide Purity: 99%

    Peptide MOQ: 1 kit (10 vials)

    Customized ,Wholesale ,In Stock, Fast Delivery


    We offer various types of peptides,about the peptides,we can provide the good quality,the good price.

    Customers who have ordered our products(peptides)have had very good feedback.

    World wide relaible buyers can contact us about the peptides.


    Shop Dermorphin-  Finished peptides spot goods-Detailed Image 1


    Shop Dermorphin-  Finished peptides spot goods-Detailed Image 2
    Shop Dermorphin-  Finished peptides spot goods-Detailed Image 3


    Shop Dermorphin-  Finished peptides spot goods-Detailed Image 4
    Shop Dermorphin-  Finished peptides spot goods-Detailed Image 5

    Shop PEG MGF 2mg 10 yeras API, Raw, Peptide factory supplier 99 purity-Detailed Image 12 

















     Packing Detail 

     Shop MelanotanI High Quality Hot Sale 10mg Wholesale 99 purity-Detailed Image 18

    Shop High-Quality HGH-Fragment 176-191 for Targeted Fat Metabolism Studies-Detailed Image 7
    Shop High-Quality HGH-Fragment 176-191 for Targeted Fat Metabolism Studies-Detailed Image 8




     

    Hot Selling Peptide Product  



    Shop High-Quality HGH-Fragment 176-191 for Targeted Fat Metabolism Studies-Detailed Image 9

    Shop High-Quality HGH-Fragment 176-191 for Targeted Fat Metabolism Studies-Detailed Image 10



    Shop High-Quality HGH-Fragment 176-191 for Targeted Fat Metabolism Studies-Detailed Image 11

    Company Profile


    Huahui Biotechnology Co., Ltd. is located in SHENZHEN Province, China.


    We specialize in high-quality research chemicals, pharmaceutical intermediates and peptide raw materials export.


    Equipped with professional technical team, advanced production equipment and strict quality management, all products meet international safety and environmental protection standards.


    We provide double customs clearance and door-to-door delivery service. Covering the United States, Canada, Australia, United Kingdom, Germany, Spain, Italy, Sweden, Netherlands, Poland, Czech Republic, Mexico, Russia, Ukraine and Kazakhstan.


    With years of export experience, we have established stable reputation and reliable supply capacity. A full range of products can meet your one-stop purchasing needs.


    We always adhere to the principle of Quality First, Customer Supreme, Credit Oriented, and sincerely welcome global customers to create long-term win-win cooperation.

    Shop High-Quality HGH-Fragment 176-191 for Targeted Fat Metabolism Studies-Detailed Image 12
    Shop High-Quality HGH-Fragment 176-191 for Targeted Fat Metabolism Studies-Detailed Image 13


      Customer case Shop High-Quality HGH-Fragment 176-191 for Targeted Fat Metabolism Studies-Detailed Image 14



      Product Delivery Shop High-Quality HGH-Fragment 176-191 for Targeted Fat Metabolism Studies-Detailed Image 15



     Why choose us



    Why Choose Us


      1. 1.All peptides and raw materials adopt 99%+ high purity standard.
      2. 2.100% safe and guaranteed delivery.
      3. 3.Overseas warehouses and sufficient stock in USA, Canada, Europe and Australia.
      4. 4. Factory direct sales with affordable price and high cost performance.
      5. 5.Multiple payment methods are available:
      6. Credit Card, Bank Transfer, Alipay, Apple Pay, Google Pay, WeChat Pay, Bitcoin, USDT.
    Shop High-Quality HGH-Fragment 176-191 for Targeted Fat Metabolism Studies-Detailed Image 16



    Basic Info
    Product Name:

    LL-37

    Other Name:

    Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

    CAS No.:

    154947-66-7

    Molecular Formula:

    C205H340N60O53

    InChIKeys:

    POIUWJQBRNEFGX-XAMSXPGMSA-N

    Molecular Weight:

    0

    EC Number:

    211-519-9

    Color/Form:

    White to off-white

    Categories:

    Polypeptide

    Characteristics
    Water Solubility:

    Soluble to 1 mg/ml in water

  • Seller Information
    Business Type:

    Trader

    Main Products:

    Tirzepatide,Retatrutide,GHK-CU,NAD+,KPV,SS-31

    Location:

    1st Floor, Building 1, No. 2816 Yixian Road, Baoshan District, Shanghai

    Year of Establishment:

    2025

  • Country Product Purchase Quantity Date Posted
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.