Product
Supplier
Encyclopedia
Inquiry
Home > Cosmetic Ingredient > Abrasive > LL-37 for Sale > GHK-CU CU50 CU100 Recombinant peptide Quick inventory delivery
GHK-CU CU50 CU100 Recombinant peptide Quick inventory delivery buy - large image1
GHK-CU CU50 CU100 Recombinant peptide Quick inventory delivery buy - image1
GHK-CU CU50 CU100 Recombinant peptide Quick inventory delivery buy - image2
GHK-CU CU50 CU100 Recombinant peptide Quick inventory delivery buy - image3
GHK-CU CU50 CU100 Recombinant peptide Quick inventory delivery buy - image4
GHK-CU CU50 CU100 Recombinant peptide Quick inventory delivery buy - image5
GHK-CU CU50 CU100 Recombinant peptide Quick inventory delivery buy - image6

GHK-CU CU50 CU100 Recombinant peptide Quick inventory delivery

TDS

Unit Price:

$1/MT FOB

Get Latest Price
CAS No.:

154947-66-7

Grade:

Pharmaceutical Grade

Content:

99%

Port:

shenzhen

Brand:

sc

Packaging:

50 milligrams /100 milligrams. 10 bottles per box

Price valid (until):

2027-03-31

Company Type:
Trader
Location:
Hongkong, China
Qualification:
Main Products:

tr

  • Product Description

  • Seller Information

  • Description


       Product Detail   


    Sales manager: Sofia

    WhatsApp:+85293652837

    We offer various types of peptides, about peptides, we can offer good quality, good price. Customers who have ordered our products (peptides) have received very good feedback. Reliable buyers around the world can contact us about peptides

    1. Ultra-low temperature freezing: Freeze the highly active ingredients at -196 degrees to put the active ingredients into a dormant state.

    2. Effective regeneration: Add the solvent to the powder when using it, and it can be effectively regenerated after mixing, ensuring the high activity and high stability of the product. We offer various types of peptides, and we can provide excellent quality and preferential prices for peptides. The feedback from customers who have ordered our products (peptides) is very good. Reliable buyers around the world can contact us for peptide matters. We offers an unparalleled combination of quality, performance and value. If you have any questions about this product or want to learn more about how it can benefit your business, please feel free to contact us. We are committed to providing excellent customer service and helping our customers achieve their business goals.We look forward to the opportunity to work with you and help you succeed.

    Shop GHK-CU CU50 CU100 Recombinant peptide Quick inventory delivery-Detailed Image 1

    ——      FAQ     ——

    Question 1: How is the product after-sales service?

    A: We provide comprehensive after-sales support for all factory-produced products. We have a professional technical and after-sales team who are always ready to solve any problems you encounter during the subsequent use, ensuring your rights.

    Question 2: Can samples be provided?

    A: Of course. We are more than happy to provide samples. The samples are free of charge, but the related transportation costs need to be borne by you.

    Question 3: What payment methods are available? How do I start the payment?

    A: We support multiple payment methods.You can choose the most convenient method to complete the payment.

    Question 4: How can I confirm the product quality before placing an order?

    A: We fully understand your concern about the quality. You can apply for a free sample for testing (you only need to pay for the shipping cost). Additionally, you can provide us with detailed product specifications and specific requirements, and we will produce and control the quality strictly according to your standards.

    Question 5: How long is the delivery time?

    A: We promise to arrange the shipment within 3 to 7 days after receiving the order, and will promptly provide the tracking number. The specific delivery time may vary depending on the logistics situation in your country or region. We recommend that you consult our customer service staff for a more accurate estimated time.

    Shop GHK-CU CU50 CU100 Recombinant peptide Quick inventory delivery-Detailed Image 2

    ——      Why Choose Us      ——

    1. We supply Peptides, APIs & Intermediates and so on to satisfy your needs;
    2. We will reply you for your inquiry in 24 hours;
    3. Strictly on selecting raw materials . Our Q&C team will inspect every product quality strictly before delivery;

    4. Reasonable & competitive price, fast lead time ;

    5. After delivery, we will track the products for you once every two days, until you get the products. When you got the goods, if you have any questions about the problem, contact with us, we will offer the solve way for you ;

    6. 100% safe delivery, guaranteed delivery .

    Shop GHK-CU CU50 CU100 Recombinant peptide Quick inventory delivery-Detailed Image 3

    ——      Our advantage    ——

    We have many years of trading experience and are professional Chemical raw materials, medicine, Pharmaceutical raw material suppliers in overseas . Hope to cooperate with you for a long time and achieve win-win purpose. Our experienced staff is committed to strict quality control and attentive customer service and is always available to discuss your requirements and ensure complete customer satisfaction. Our company firmly believes that all products must comply with international quality standards. We therefore focus on sourcing quality materials and ensuring strict internal process controls. Our professional inspectors ensure that the products delivered to our customers are perfect. Our company adhere to the "customer first, reputation assurance, quality assurance, professional service" policy. No matter what type of product you need, you can contact us at any time, we will provide high quality products in the fastest and best way to achieve customer satisfaction. In addition, we will provide the best service to our customers. We look forward to establishing long-term business relations with overseas on the basis of mutual benefit in the near future. If you are interested in our products or companies, please feel free to contact us for more details!

    Shop GHK-CU CU50 CU100 Recombinant peptide Quick inventory delivery-Detailed Image 4 Shop GHK-CU CU50 CU100 Recombinant peptide Quick inventory delivery-Detailed Image 5 Shop GHK-CU CU50 CU100 Recombinant peptide Quick inventory delivery-Detailed Image 6 Shop GHK-CU CU50 CU100 Recombinant peptide Quick inventory delivery-Detailed Image 7

    ——       Our factory      ——

    Shop GHK-CU CU50 CU100 Recombinant peptide Quick inventory delivery-Detailed Image 8 Shop GHK-CU CU50 CU100 Recombinant peptide Quick inventory delivery-Detailed Image 9

    ——      Packing & Delivery     ——Shop GHK-CU CU50 CU100 Recombinant peptide Quick inventory delivery-Detailed Image 10 Shop GHK-CU CU50 CU100 Recombinant peptide Quick inventory delivery-Detailed Image 11

    Certificates
    • GHK-CU CU50 CU100 Recombinant peptide Quick inventory delivery Certificates 1

    Basic Info
    Product Name:

    LL-37

    Other Name:

    Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES;Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

    CAS No.:

    154947-66-7

    Molecular Formula:

    C205H340N60O53

    InChIKeys:

    POIUWJQBRNEFGX-XAMSXPGMSA-N

    Molecular Weight:

    0

    EC Number:

    211-519-9

    Color/Form:

    White to off-white

    Categories:

    Abrasive

    Characteristics
    Water Solubility:

    Soluble to 1 mg/ml in water

  • Seller Information
    Business Type:

    Trader

    Main Products:

    tr

    Location:

    B27 SHING LEE COMM BLDG 8WING KUT ST CENTRAL HONGKONG

    Total Annual Revenue:

    Less than $1 million

    Total Employees:

    5-10

    Year of Establishment:

    2026

  • Country Product Purchase Quantity Date Posted
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.