Product
Supplier
Encyclopedia
Inquiry
Home > Pharmaceutical Intermediates > Bulk Drug Intermediates > LL-37 for Sale > 99% Purity LL37 and High Quality CAS 154947-66-7
99% Purity LL37  and High Quality  CAS 154947-66-7 buy - large image1
99% Purity LL37  and High Quality  CAS 154947-66-7 buy - image1
99% Purity LL37  and High Quality  CAS 154947-66-7 buy - image2
99% Purity LL37  and High Quality  CAS 154947-66-7 buy - image3
99% Purity LL37  and High Quality  CAS 154947-66-7 buy - image4
99% Purity LL37  and High Quality  CAS 154947-66-7 buy - image5
99% Purity LL37  and High Quality  CAS 154947-66-7 buy - image6

99% Purity LL37 and High Quality CAS 154947-66-7

TDS 1 Inquiries

Unit Price: Get Latest Price
CAS No.:

154947-66-7

Grade:

Pharmaceutical Grade

Content:

99%

Port:

china

Brand:

Qihang

Packaging:

10mg 15mg 20mg 30mg 50mg 60mg,10vials/box

Price valid (until):

2026-06-27

Company Type:
Trader
Location:
China
Qualification:
Main Products:

Semaglutide,Tirzepatide,Retatrutide,MOTS-C,TB500,KPV

  • Product Description

  • Seller Information

  • Inquiry History

  • Description


      Product Detail  


    Name: LL37

    CAS No.: 154947-66-7

    Purity: >99% (or refer to the Certificate of Analysis)

    Storage Condition: Dry, dark and at 0 - 4 C for short term (days to weeks) or -20 C for long term (months to years).

    Shelf Life: >2 years if stored properly

    Stock Solution Storage: 0 - 4 C for short term (days to weeks), or -20 C for long term (months).

    LL‑37 is the only human cathelicidin antimicrobial peptide, derived from the hCAP18 protein. It is a 37‑amino acid cationic, amphipathic α‑helical peptide with broad immunomodulatory and host defense functions.
    CAS Number: 154947-66-7
    It exhibits potent antimicrobial activity against Gram‑positive and Gram‑negative bacteria, fungi, and enveloped viruses. Beyond direct microbial killing, LL‑37 regulates inflammation, promotes wound healing, modulates immune cell recruitment, and supports tissue repair. It is widely studied in immunology, dermatology, infection research, and mucosal defense.

    Production:
    Manufactured via solid-phase peptide synthesis (SPPS), followed by purification and lyophilization to obtain the final product.


    NOTE: This product was prepared by chemical synthesis. Used only for research. Not for human use.


    Shop High quality Thymosin α1 Pure  Thymosin Alpha 1 Thymalfasin immunomodulation-Detailed Image 1 Shop High quality Thymosin α1 Pure  Thymosin Alpha 1 Thymalfasin immunomodulation-Detailed Image 2 Shop High quality Thymosin α1 Pure  Thymosin Alpha 1 Thymalfasin immunomodulation-Detailed Image 3 Shop High quality Thymosin α1 Pure  Thymosin Alpha 1 Thymalfasin immunomodulation-Detailed Image 4 Shop High quality Thymosin α1 Pure  Thymosin Alpha 1 Thymalfasin immunomodulation-Detailed Image 5

    Items Specifications
    Product Name  LL73
    Cas No 154947-66-7
    Appearance white powder
    Storage Keep in a cool, dry, dark location in a tightly sealed container or cylinder.

    Our company was established in 2024. Our main products are various peptides,such as weight loss peptide, anti-wrinkle peptide, tanning titanium, and other products, reliable quality, committed to strict quality control and thoughtful customer service, our experienced staff is always available to discuss your requirements to ensure customer satisfaction.
    We always put the value of our customers as our top priority, we focus on high quality, competitive price, flexible order quantity, timely delivery. Our products are mainly exported to European countries, the United Kingdom, the United States, Canada and Australia. Our products are widely recognized and trusted by users.
    We have our own delivery line to Canada, USA, UK, Spain, Poland, Netherland, Germany, Russia, Kazakhstan, Ukraine, etc. Door to door without any customs clearance issues.
    We therefore focus on sourcing materials of perfect quality and ensure strict internal process control.Our goal is to survive by quality and develop by reputation.
    Our advantage: Safe, effective and efficient customer service. Our products are produced quickly and safely. Provide samples before regular order. We focus on serving foreign customers, our products sell well in many countries. We ensure quality products and reasonable prices. We have good after-sales service, solve any type of problem, the goal is to make every customer satisfied with our company and get the best reputation.
    Constantly strive for high quality products, competitive prices, professional support, effective team, cooperative and honest cooperation, good after-sales work
    In the past two years, our products have been spread across Europe, South America, North America, Southeast Asia, Africa and other more than 30 countries in the world. We work with friends all over the world to develop quality products, reasonable prices and safe and efficient transportation. Products are ordered in quantities ranging from milligrams to tons. Meet the new and old customers to buy.Shop High quality Thymosin α1 Pure  Thymosin Alpha 1 Thymalfasin immunomodulation-Detailed Image 6 Shop High quality Thymosin α1 Pure  Thymosin Alpha 1 Thymalfasin immunomodulation-Detailed Image 7

    Certificates

    Basic Info
    Product Name:

    LL-37

    Other Name:

    Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

    CAS No.:

    154947-66-7

    Molecular Formula:

    C205H340N60O53

    InChIKeys:

    POIUWJQBRNEFGX-XAMSXPGMSA-N

    Molecular Weight:

    0

    EC Number:

    211-519-9

    Color/Form:

    White to off-white

    Characteristics
    Water Solubility:

    Soluble to 1 mg/ml in water

  • Seller Information
    Business Type:

    Trader

    Main Products:

    Semaglutide,Tirzepatide,Retatrutide,MOTS-C,TB500,KPV

    Location:

    708-95, 7th Floor, Building C, Hangchuang International Plaza, No. 239, Shenzhou 4th Road, National Civil Aerospace Industrial Base, Xi'an City, Shaanxi Province

    Payment Terms:

    TT against copy of documents,D/P,L/C,D/A,O/A,TT against B/L draft before shipment,100% TT in advance

    Average lead Time:

    10

    Total Annual Revenue:

    $1 million-$2.5 million

    Total Employees:

    11-50

    Year of Establishment:

    2025

    Company Profile :
    Qihang Zhouji Biotechnology is an international trading enterprise specializing in the fields of medicine, health, and fine chemicals. Our main business includes global procurement, sales, and supply chain services for pharmaceutical peptides, food additives, plant extracts, pharmaceutical intermediates, and other products. Our business covers multiple countries and regions in Asia, Europe, North America, South America, and the Middle East.
    We rely on a stable high-quality supply chain, strict quality control system, and professional foreign trade operation team to provide compliant, efficient, and stable product supply and one-stop solutions for global pharmaceutical companies, food factories, health product companies, research institutions, and traders. Always adhere to quality as the core, reputation as the foundation, and customer needs as the guide, committed to becoming a professional bridge connecting high-quality resources at home and abroad, and promoting the global coordinated development of the health industry and fine chemical industry.
    In the future, we will continue to expand our global market, deepen our product layout, enhance our service capabilities, and work together with global partners to create long-term stable business value.

  • Inquiry History
    1 Inquiries
    Country Product Purchase Quantity Date Posted
    Indonesia

    LL-37

    5 MG Jun 23, 2026
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.