Product
Supplier
Encyclopedia
Inquiry
Home > Cosmetic Ingredient > Abrasive > LL-37 for Sale > IGF-1LR3 IG01 IG1 MOTS-c MS10 MS40 SLU-PP-322 Epithalon 322 ET10 ET50 made in China
IGF-1LR3 IG01 IG1 MOTS-c MS10 MS40 SLU-PP-322 Epithalon 322  ET10 ET50 made in China buy - large image1
IGF-1LR3 IG01 IG1 MOTS-c MS10 MS40 SLU-PP-322 Epithalon 322  ET10 ET50 made in China buy - image1
IGF-1LR3 IG01 IG1 MOTS-c MS10 MS40 SLU-PP-322 Epithalon 322  ET10 ET50 made in China buy - image2
IGF-1LR3 IG01 IG1 MOTS-c MS10 MS40 SLU-PP-322 Epithalon 322  ET10 ET50 made in China buy - image3
IGF-1LR3 IG01 IG1 MOTS-c MS10 MS40 SLU-PP-322 Epithalon 322  ET10 ET50 made in China buy - image4
IGF-1LR3 IG01 IG1 MOTS-c MS10 MS40 SLU-PP-322 Epithalon 322  ET10 ET50 made in China buy - image5
IGF-1LR3 IG01 IG1 MOTS-c MS10 MS40 SLU-PP-322 Epithalon 322  ET10 ET50 made in China buy - image6

IGF-1LR3 IG01 IG1 MOTS-c MS10 MS40 SLU-PP-322 Epithalon 322 ET10 ET50 made in China

TDS 1 Inquiries

Unit Price:

$1/G FOB

Get Latest Price
CAS No.:

154947-66-7

Grade:

Pharmaceutical Grade

Content:

99%

Port:

shenzhen

Brand:

sc

Packaging:

0.1 mg / 1 mg / 5mg /10mg /40mg /50mg. 10 bottles per box

Price valid (until):

2027-06-30

Company Type:
Trader
Location:
Hongkong, China
Qualification:
Main Products:

tr

  • Product Description

  • Seller Information

  • Inquiry History

  • Description

    Sales manager: Sofia

    WhatsApp:+85244569741

    Sincerely look forward to your inquiries about our products.


    ——      Product Detail    ——

    1. Ultra-High Purity
    Each batch is synthesized and purified to >99% purity (HPLC), ensuring reliable and reproducible results in sensitive experiments.

    2.Accurate Dosing & Consistency
    Our peptides are precisely weighed and vacuum-sealed under sterile conditions. Batch-to-batch consistency is rigorously maintained.

    3.Endotoxin-Free & Sterile Processing
    Manufactured in a cleanroom environment, our peptides are free from endotoxins, microbial contamination, and other impurities that could interfere with cell-based or in vivo studies.

    4. Advanced Manufacturing Capabilities

    Cutting-Edge Facilities: High-precision equipment ensuring purity and bioactivity.

    Scalable Production: From milligram-scale research peptides to multi-kilogram industrial batches.

    5. Innovation & Customer Commitment

    Reliable Supply Chain: Competitive pricing & timely global delivery.

    Global Reach: Trusted by researchers, pharmaceutical firms & industrial clients worldwide.

    Shop Glutathione CAS154947-66-7 GT600 GT1500 High purity and prompt delivery-Detailed Image 1

    ——      FAQ     ——

    Question 1: How is the product after-sales service?

    A: We provide comprehensive after-sales support for all factory-produced products. We have a professional technical and after-sales team who are always ready to solve any problems you encounter during the subsequent use, ensuring your rights.

    Question 2: Can samples be provided?

    A: Of course. We are more than happy to provide samples. The samples are free of charge, but the related transportation costs need to be borne by you.

    Question 3: What payment methods are available? How do I start the payment?

    A: We support multiple payment methods.You can choose the most convenient method to complete the payment.

    Question 4: How can I confirm the product quality before placing an order?

    A: We fully understand your concern about the quality. You can apply for a free sample for testing (you only need to pay for the shipping cost). Additionally, you can provide us with detailed product specifications and specific requirements, and we will produce and control the quality strictly according to your standards.

    Question 5: How long is the delivery time?

    A: We promise to arrange the shipment within 3 to 7 days after receiving the order, and will promptly provide the tracking number. The specific delivery time may vary depending on the logistics situation in your country or region. We recommend that you consult our customer service staff for a more accurate estimated time.

    Shop Glutathione CAS154947-66-7 GT600 GT1500 High purity and prompt delivery-Detailed Image 2

    ——      Why Choose Us      ——

    1. We supply Peptides, APIs & Intermediates and so on to satisfy your needs;
    2. We will reply you for your inquiry in 24 hours;
    3. Strictly on selecting raw materials . Our Q&C team will inspect every product quality strictly before delivery;

    4. Reasonable & competitive price, fast lead time ;

    5. After delivery, we will track the products for you once every two days, until you get the products. When you got the goods, if you have any questions about the problem, contact with us, we will offer the solve way for you ;

    6. 100% safe delivery, guaranteed delivery .

    Shop Glutathione CAS154947-66-7 GT600 GT1500 High purity and prompt delivery-Detailed Image 3

    ——      Storage Conditions     ——

    Should be stored in the refrigerator at 2°C to 8°C, away from light.

    If required, each single-dose pen can be stored unrefrigerated at a temperature not exceeding 30°C for up to 21 days, but once stored at room temperature it should not be returned to the refrigerator. If not used within 21 days after removal from the refrigerator, it should be discarded. Do not freeze tilpotide and if frozen, do not use.

    Shop Glutathione CAS154947-66-7 GT600 GT1500 High purity and prompt delivery-Detailed Image 4 Shop Glutathione CAS154947-66-7 GT600 GT1500 High purity and prompt delivery-Detailed Image 5 Shop Glutathione CAS154947-66-7 GT600 GT1500 High purity and prompt delivery-Detailed Image 6

    ——       Our factory      ——

    1.We have more than 10 years of experience in the field of chemical industry, the company's products are exported to more than 60 countries overseas, of which 80% are exported to Europe and America, 20% are exported to Southeast Asia, the Middle East, South Africa and other regions.

    2.We have our own production plant and R & D center, to provide customers with technical support, product customization, free recipes and other whole industry chain services. Support full video inspection, testing, global delivery package.

    3.We accept sample orders for testing, after purchasing products from our factory, we have a professional technical team and after-sales team to serve you and solve all your future problems. 100% quality assurance, 100% safe delivery.

    Shop Glutathione CAS154947-66-7 GT600 GT1500 High purity and prompt delivery-Detailed Image 7 Shop Glutathione CAS154947-66-7 GT600 GT1500 High purity and prompt delivery-Detailed Image 8

    ——        Customer Feedback       ——

    Shop Glutathione CAS154947-66-7 GT600 GT1500 High purity and prompt delivery-Detailed Image 9

    ——      Packing & Delivery     ——

    Shop Glutathione CAS154947-66-7 GT600 GT1500 High purity and prompt delivery-Detailed Image 10 Shop Glutathione CAS154947-66-7 GT600 GT1500 High purity and prompt delivery-Detailed Image 11

    Certificates
    • IGF-1LR3 IG01 IG1 MOTS-c MS10 MS40 SLU-PP-322 Epithalon 322  ET10 ET50 made in China Certificates 1

    Basic Info
    Product Name:

    LL-37

    Other Name:

    Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

    CAS No.:

    154947-66-7

    Molecular Formula:

    C205H340N60O53

    InChIKeys:

    POIUWJQBRNEFGX-XAMSXPGMSA-N

    Molecular Weight:

    0

    EC Number:

    211-519-9

    Color/Form:

    White to off-white

    Categories:

    Abrasive

    Characteristics
    Water Solubility:

    Soluble to 1 mg/ml in water

  • Seller Information
    Business Type:

    Trader

    Main Products:

    tr

    Location:

    B27 SHING LEE COMM BLDG 8WING KUT ST CENTRAL HONGKONG

    Average lead Time:

    1

    Total Annual Revenue:

    Less than $1 million

    Total Employees:

    5-10

    Year of Establishment:

    2026

    20 years of production experience in peptide products

    Safe and unobstructed shipping channels|High quality guaranteed|

    Our company is located in Guangzhou, China. Its production facilities are situated in a modern 5,000-square-meter factory. As a private enterprise, we have over 200 professional employees and are actively expanding our team to support future growth. Over the past two decades, as a comprehensive enterprise integrating research, production, processing and export in the chemical industry, we have performed exceptionally well. Since our establishment, we have always adhered to the principles of "honest management, strict quality control, and customer-oriented service", and have received continuous praise from global customers. Our company is a Chinese manufacturer of peptide products, guaranteeing product quality and effectiveness at affordable prices. We offer reliable and secure shipping channels with discreet delivery to ensure safe and timely arrival.


  • Inquiry History
    1 Inquiries
    Country Product Purchase Quantity Date Posted
    Indonesia

    LL-37

    5 MG Jun 23, 2026
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.