Product
Supplier
Encyclopedia
Inquiry
Home > Cosmetic Ingredient > Abrasive > LL-37 for Sale > BAC water Benzyl Alcoh 0.9% Asetic Acid water 0.6% WA3 WA10 BA3 BA10 AA3 AA10 factory outlet
BAC water Benzyl Alcoh 0.9% Asetic Acid water 0.6% WA3 WA10 BA3 BA10 AA3 AA10 factory outlet buy - large image1
BAC water Benzyl Alcoh 0.9% Asetic Acid water 0.6% WA3 WA10 BA3 BA10 AA3 AA10 factory outlet buy - image1
BAC water Benzyl Alcoh 0.9% Asetic Acid water 0.6% WA3 WA10 BA3 BA10 AA3 AA10 factory outlet buy - image2
BAC water Benzyl Alcoh 0.9% Asetic Acid water 0.6% WA3 WA10 BA3 BA10 AA3 AA10 factory outlet buy - image3
BAC water Benzyl Alcoh 0.9% Asetic Acid water 0.6% WA3 WA10 BA3 BA10 AA3 AA10 factory outlet buy - image4
BAC water Benzyl Alcoh 0.9% Asetic Acid water 0.6% WA3 WA10 BA3 BA10 AA3 AA10 factory outlet buy - image5
BAC water Benzyl Alcoh 0.9% Asetic Acid water 0.6% WA3 WA10 BA3 BA10 AA3 AA10 factory outlet buy - image6

BAC water Benzyl Alcoh 0.9% Asetic Acid water 0.6% WA3 WA10 BA3 BA10 AA3 AA10 factory outlet

TDS

Unit Price:

$1/G FOB

Get Latest Price
CAS No.:

154947-66-7

Grade:

Pharmaceutical Grade

Content:

99%

Port:

shenzhen

Brand:

sc

Packaging:

3mg / 10 mg. 10 bottles per box

Price valid (until):

2027-09-30

Company Type:
Trader
Location:
Hongkong, China
Qualification:
Main Products:

tr

  • Product Description

  • Seller Information

  • Description

    Sales manager: Sofia

    WhatsApp:+85244569741

    Sincerely look forward to your inquiries about our products.


    ——      Product Detail      ——

    1. Ultra-High Purity
    Each batch is synthesized and purified to >99% purity (HPLC), ensuring reliable and reproducible results in sensitive experiments.

    2.Accurate Dosing & Consistency
    Our peptides are precisely weighed and vacuum-sealed under sterile conditions. Batch-to-batch consistency is rigorously maintained.

    3.Endotoxin-Free & Sterile Processing
    Manufactured in a cleanroom environment, our peptides are free from endotoxins, microbial contamination, and other impurities that could interfere with cell-based or in vivo studies.

    4. Advanced Manufacturing Capabilities

    Cutting-Edge Facilities: High-precision equipment ensuring purity and bioactivity.

    Scalable Production: From milligram-scale research peptides to multi-kilogram industrial batches.

    5. Innovation & Customer Commitment

    Reliable Supply Chain: Competitive pricing & timely global delivery.

    Global Reach: Trusted by researchers, pharmaceutical firms & industrial clients worldwide.

    Shop L-Carn itine LC600 Overseas warehouse delivery Ensure safe delivery-Detailed Image 1

    Shop L-Carn itine LC600 Overseas warehouse delivery Ensure safe delivery-Detailed Image 2

    ——      Why Choose Us      ——

    1. We supply Peptides, APIs & Intermediates and so on to satisfy your needs;
    2. We will reply you for your inquiry in 24 hours;
    3. Strictly on selecting raw materials . Our Q&C team will inspect every product quality strictly before delivery;

    4. Reasonable & competitive price, fast lead time ;

    5. After delivery, we will track the products for you once every two days, until you get the products. When you got the goods, if you have any questions about the problem, contact with us, we will offer the solve way for you ;

    6. 100% safe delivery, guaranteed delivery.

    Shop L-Carn itine LC600 Overseas warehouse delivery Ensure safe delivery-Detailed Image 3

    ——      Our advantage    ——

    1.We have more than 10 years of experience in the field of chemical industry, the company's products are exported to more than 60 countries overseas, of which 80% are exported to Europe and America, 20% are exported to Southeast Asia, the Middle East, South Africa and other regions.

    2.We have our own production plant and R & D center, to provide customers with technical support, product customization, free recipes and other whole industry chain services. Support full video inspection, testing, global delivery package.

    3.We accept sample orders for testing, after purchasing products from our factory, we have a professional technical team and after-sales team to serve you and solve all your future problems. 100% quality assurance, 100% safe delivery.

    Shop L-Carn itine LC600 Overseas warehouse delivery Ensure safe delivery-Detailed Image 4

    ——      Storage Conditions     ——

    Peptide Storage Guidelines: General Tips

    When storing peptides, remember to:
    • Store peptide in a cold, dry, dark place
    • Avoid repeated freezing and thawing of peptide
    • Avoid overexposure to the air
    • Avoid light exposure
    • Avoid storing peptides in solution long term
    • Aliquot peptide according to experimental requirements

    Shop L-Carn itine LC600 Overseas warehouse delivery Ensure safe delivery-Detailed Image 5 Shop L-Carn itine LC600 Overseas warehouse delivery Ensure safe delivery-Detailed Image 6 ——       Our factory      ——

    Our products enjoy good reputation both at home and abroad. Our trade partners are around the world, mainly in America,Europe,Australia,South East Asia ,Middle East and South Africa. In order to serve customers well, the company has established special technical department and after-sale service department. We will make careful reply if you get any question.

    The company with all the employees will constantly purse excellent quality, perfect brand and our image, and adheres to our spirit of honesty, diligence, seeking truth and progress and insists on business philosophy of quality as life and service as soul. We will satisfy market demands by top products and better service, and will welcome market challenge forever.

    Shop L-Carn itine LC600 Overseas warehouse delivery Ensure safe delivery-Detailed Image 7 Shop L-Carn itine LC600 Overseas warehouse delivery Ensure safe delivery-Detailed Image 8 Shop L-Carn itine LC600 Overseas warehouse delivery Ensure safe delivery-Detailed Image 9

    ——        Customer Feedback       —— Shop L-Carn itine LC600 Overseas warehouse delivery Ensure safe delivery-Detailed Image 11

    ——      Packing & Delivery     ——

    Shop L-Carn itine LC600 Overseas warehouse delivery Ensure safe delivery-Detailed Image 12 Shop L-Carn itine LC600 Overseas warehouse delivery Ensure safe delivery-Detailed Image 13 Shop L-Carn itine LC600 Overseas warehouse delivery Ensure safe delivery-Detailed Image 14

    Welcome to be our distinguished customer,please do not hesitate to contact us!

    Certificates
    • BAC water Benzyl Alcoh 0.9% Asetic Acid water 0.6% WA3 WA10 BA3 BA10 AA3 AA10 factory outlet Certificates 1

    Basic Info
    Product Name:

    LL-37

    Other Name:

    Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

    CAS No.:

    154947-66-7

    Molecular Formula:

    C205H340N60O53

    InChIKeys:

    POIUWJQBRNEFGX-XAMSXPGMSA-N

    Molecular Weight:

    0

    EC Number:

    211-519-9

    Color/Form:

    White to off-white

    Categories:

    Abrasive

    Characteristics
    Water Solubility:

    Soluble to 1 mg/ml in water

  • Seller Information
    Business Type:

    Trader

    Main Products:

    tr

    Location:

    B27 SHING LEE COMM BLDG 8WING KUT ST CENTRAL HONGKONG

    Total Annual Revenue:

    Less than $1 million

    Total Employees:

    5-10

    Year of Establishment:

    2026

  • Country Product Purchase Quantity Date Posted
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.