Product
Supplier
Encyclopedia
Inquiry
Home > Cosmetic Ingredient > Tonics > LL-37 for Sale > TB500 Thymosin B4 Acetate BC5 BC10 BC20 BT5 BT10 CAS154947-66-7 Of the best quality
TB500 Thymosin B4 Acetate BC5 BC10 BC20 BT5 BT10 CAS154947-66-7 Of the best quality buy - large image1
TB500 Thymosin B4 Acetate BC5 BC10 BC20 BT5 BT10 CAS154947-66-7 Of the best quality buy - image1
TB500 Thymosin B4 Acetate BC5 BC10 BC20 BT5 BT10 CAS154947-66-7 Of the best quality buy - image2
TB500 Thymosin B4 Acetate BC5 BC10 BC20 BT5 BT10 CAS154947-66-7 Of the best quality buy - image3
TB500 Thymosin B4 Acetate BC5 BC10 BC20 BT5 BT10 CAS154947-66-7 Of the best quality buy - image4
TB500 Thymosin B4 Acetate BC5 BC10 BC20 BT5 BT10 CAS154947-66-7 Of the best quality buy - image5
TB500 Thymosin B4 Acetate BC5 BC10 BC20 BT5 BT10 CAS154947-66-7 Of the best quality buy - image6

TB500 Thymosin B4 Acetate BC5 BC10 BC20 BT5 BT10 CAS154947-66-7 Of the best quality

TDS

Unit Price:

$1/G FOB

Get Latest Price
CAS No.:

154947-66-7

Grade:

Pharmaceutical Grade

Content:

99%

Port:

shenzhen

Brand:

sc

Packaging:

5 mg /10 mg / 15 mg / 20 mg / 30 mg / 10 tubes per box

Price valid (until):

2027-04-14

Company Type:
Trader
Location:
Hongkong, China
Qualification:
Main Products:

tr

  • Product Description

  • Seller Information

  • Description


      Product Detail  


    Business Manager: Hailey
    WhatsApp: +852 4481 4820

    Shop TB500 Thymosin B4 Acetate BC5 BC10 BC20 BT5 BT10 CAS154947-66-7 Of the best quality-Detailed Image 1

               Brief Introduction of TB500:

                           TB500 (a synthetic molecule derived from the active domain of thymosin β4) is primarily used in anti-fibrosis and wound repair research. Specific applications include:


                   1) Tissue Repair and Angiogenesis:

    TB500 accelerates wound healing and skin repair by inhibiting the Akt signaling pathway and promoting endothelial cell differentiation, dermal angiogenesis, keratinocyte migration, and collagen deposition.

                   2) Anti-inflammatory Effects:

    Its active ingredients can reduce inflammatory responses, creating a favorable environment for tissue repair.

                   3) Experimental Research:

    TB500 is commonly used in in vitro cell-based assays (such as T cell proliferation and cell survival promotion) and animal model studies. The solvent formulation should be adjusted according to experimental requirements.

               ※ Note: TB500 is for research use only. Specific applications must adhere to experimental protocols and literature guidance.

    Shop TB500 Thymosin B4 Acetate BC5 BC10 BC20 BT5 BT10 CAS154947-66-7 Of the best quality-Detailed Image 2

               Company Profile

                         The company possesses strong R&D capabilities, exquisite synthesis techniques, and advanced quality control measures. We actively engage in joint ventures and cooperation with major enterprises and manufacturers, and serve society and users with an industrialization development concept.
                         We always adhere to the principle of market demand orientation, continuously develop new chemical products and pharmaceutical intermediates with high technological content, and mainly export to numerous countries and regions such as the United States, India, South Africa, and Nigeria. We have rich export experience, ensuring transportation safety, and being able to ensure that every customer can receive the goods safely and promptly.

    Shop TB500 Thymosin B4 Acetate BC5 BC10 BC20 BT5 BT10 CAS154947-66-7 Of the best quality-Detailed Image 3

    ------Why choose us------

             Rich experience
                     1. Our company is a professional and leading factory with many years of experience in the pharmaceutical field in China.
                     2. We have good feedback from customers all over the world. OEM service


                     1.Add customer logo
                     2. Redesign labels and packaging boxes according to customer requirements
                     3. Bottle cap color can be customized Shipping service


                     1. Shipped within 48 hours after payment is received.
                     2. Small orders are shipped via express door-to-door.
                     3. The goods arrive in 7-10 days 24 hours service


                     1.Reply your inquiry within 10 hours
                     2. Continuously track goods and update information to customers
                     3. After-sales service at any time

    Shop TB500 Thymosin B4 Acetate BC5 BC10 BC20 BT5 BT10 CAS154947-66-7 Of the best quality-Detailed Image 4

    ------lntroduce------

                 Our products enjoy good reputation both at home and abroad. Our trade partners are around the world, mainly in America,Europe,Australia,South East Asia ,Middle East and South Africa. In order to serve customers well, the company has established special technical department and after-sale service department. We will make careful reply if you get any question.

                 The company with all the employees will constantly purse excellent quality, perfect brand and our image, and adheres to our spirit of honesty, diligence, seeking truth and progress and insists on business philosophy of quality as life and service as soul. We will satisfy market demands by top products and better service, and will welcome market challenge forever.

    Shop TB500 Thymosin B4 Acetate BC5 BC10 BC20 BT5 BT10 CAS154947-66-7 Of the best quality-Detailed Image 5                       1 .We are very experienced with this field(more than 10 years);
                          2.Good after-sales service
                          3.100% quality guaranteed;
                          4.We accept sample order for testing;
                          5.Strong supply ability
    Shop TB500 Thymosin B4 Acetate BC5 BC10 BC20 BT5 BT10 CAS154947-66-7 Of the best quality-Detailed Image 6

                 Key Specifications/ Special Features:
                         As a leading peptide manufacturing powerhouse, we specialize in producing high - quality peptides with unmatched precision and consistency. Our state - of - the - art facilities are equipped with advanced synthesis and purification technologies, ensuring that each peptide product meets the highest industry standards. Whether it's pharmaceutical - grade peptides for research and development, functional peptides for nutraceuticals, or cosmeceutical peptides for skincare applications, we offer a comprehensive range of solutions.

                          We also offer a wide variety of peptide types, such as oligopeptides, polypeptides, and modified peptides. Oligopeptides, with their small molecular size, are highly absorbable and ideal for applications where rapid penetration and bioavailability are crucial, like in dietary supplements aimed at boosting immune function or promoting muscle recovery. Polypeptides, on the other hand, are well - suited for complex biological functions and are frequently used in the development of therapeutic drugs. Modified peptides, which can be customized with specific chemical groups, open up new possibilities for targeted drug delivery and enhanced stability.

    Shop TB500 Thymosin B4 Acetate BC5 BC10 BC20 BT5 BT10 CAS154947-66-7 Of the best quality-Detailed Image 7
    Shop TB500 Thymosin B4 Acetate BC5 BC10 BC20 BT5 BT10 CAS154947-66-7 Of the best quality-Detailed Image 8
    Shop TB500 Thymosin B4 Acetate BC5 BC10 BC20 BT5 BT10 CAS154947-66-7 Of the best quality-Detailed Image 9
    Shop TB500 Thymosin B4 Acetate BC5 BC10 BC20 BT5 BT10 CAS154947-66-7 Of the best quality-Detailed Image 10

    Certificates
    • TB500 Thymosin B4 Acetate BC5 BC10 BC20 BT5 BT10 CAS154947-66-7 Of the best quality Certificates 1

    Basic Info
    Product Name:

    LL-37

    Other Name:

    Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

    CAS No.:

    154947-66-7

    Molecular Formula:

    C205H340N60O53

    InChIKeys:

    POIUWJQBRNEFGX-XAMSXPGMSA-N

    Molecular Weight:

    0

    EC Number:

    211-519-9

    Color/Form:

    White to off-white

    Categories:

    Tonics

    Characteristics
    Water Solubility:

    Soluble to 1 mg/ml in water

  • Seller Information
    Business Type:

    Trader

    Main Products:

    tr

    Location:

    B27 SHING LEE COMM BLDG 8WING KUT ST CENTRAL HONGKONG

    Total Annual Revenue:

    Less than $1 million

    Total Employees:

    5-10

    Year of Establishment:

    2026

  • Country Product Purchase Quantity Date Posted
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.