Product
Supplier
Encyclopedia
Inquiry
Home > Pharmaceutical Intermediates > Bulk Drug Intermediates > LL-37 for Sale > LL37 cosmetic peptides, freeze-dried powder, direct sale from the manufacturer.
LL37 cosmetic peptides, freeze-dried powder, direct sale from the manufacturer. buy - large image1
LL37 cosmetic peptides, freeze-dried powder, direct sale from the manufacturer. buy - image1
LL37 cosmetic peptides, freeze-dried powder, direct sale from the manufacturer. buy - image2
LL37 cosmetic peptides, freeze-dried powder, direct sale from the manufacturer. buy - image3
LL37 cosmetic peptides, freeze-dried powder, direct sale from the manufacturer. buy - image4
LL37 cosmetic peptides, freeze-dried powder, direct sale from the manufacturer. buy - image5
LL37 cosmetic peptides, freeze-dried powder, direct sale from the manufacturer. buy - image6

LL37 cosmetic peptides, freeze-dried powder, direct sale from the manufacturer.

Unit Price:

$20-25/G FOB

Get Latest Price
CAS No.:

154947-66-7

Grade:

Pharmaceutical Grade

Content:

99%

Port:

SHENZHEN

Brand:

SH

Packaging:

10mg/vial

Price valid (until):

2026-07-03

Company Type:
Trader
Location:
China
Qualification:
Main Products:

Peptides

  • Product Description

  • Seller Information

  • Description

    Description

     


     WhatsApp:+852 4733 1793





    Ll-37, Human is an amphiphilic cathepsin derived antimicrobial peptide with 37 residues and has a wide range of antibacterial activities. Ll-37, Human helps protect the cornea from infection and regulate wound healing.






    Shop LL37 cosmetic peptides, freeze-dried powder, direct sale from the manufacturer.-Detailed Image 1




    LL37 has been used as an antimicrobial agent to improve wound healing.

            LL37 has been used as a vaccine adjuvant to enhance the immune response of vaccines.

             LL37 has been used as a therapeutic agent for the treatment of inflammatory diseases such as asthma and cystic fibrosis.

                LL37 has been used as an immunomodulator to modulate the immune response and enhance the production of pro-inflammatorycytokines and chemokines.

     LL37 has been studied as a potential target for cancer therapy, due to its ability to induce apoptosis and inhibit cancer cell growth.

     LL37 has been studied as a potential target for antiviral therapy due to its ability to inhibit the replication of viruses.




    Items Specifications
    product name LL37
    Appearance Powder
    Storage condition Dry, dark, low temperature

    Shop LL37 cosmetic peptides, freeze-dried powder, direct sale from the manufacturer.-Detailed Image 2

     



    1. Expertise in Peptide Synthesis

    Extensive Experience: 7 Years of expertise in synthetic peptide development.

    Skilled Team: Experts in solid-phase and liquid-phase synthesis.

    2. Advanced Manufacturing Capabilities

    Cutting-Edge Facilities: High-precision equipment ensuring purity and bioactivity.

    Scalable Production: From milligram-scale research peptides to multi-kilogram industrial batches.

    3. Innovation & Customer Commitment

    Reliable Supply Chain: Competitive pricing & timely global delivery.

    Global Reach: Trusted by researchers, pharmaceutical firms & industrial clients worldwide.

    4. Ultra-High Purity
    Each batch is synthesized and purified to >99% purity (HPLC), ensuring reliable and reproducible results in sensitive experiments.

    5.Accurate Dosing & Consistency
    Our peptides are precisely weighed and vacuum-sealed under sterile conditions. Batch-to-batch consistency is rigorously maintained.

    6.Endotoxin-Free & Sterile Processing
    Manufactured in a cleanroom environment, our peptides are free from endotoxins, microbial contamination, and other impurities that could interfere with cell-based or in vivo studies.




    Shop LL37 cosmetic peptides, freeze-dried powder, direct sale from the manufacturer.-Detailed Image 3
    Shop LL37 cosmetic peptides, freeze-dried powder, direct sale from the manufacturer.-Detailed Image 4



    1. Ultra-High Purity


    2. Each batch is synthesized and purified to >99% purity (HPLC), ensuring reliable and reproducible results in sensitive experiments.

      2.Accurate Dosing & Consistency
      Our peptides are precisely weighed and vacuum-sealed under sterile conditions. Batch-to-batch consistency is rigorously maintained.

      3.Endotoxin-Free & Sterile Processing
      Manufactured in a cleanroom environment, our peptides are free from endotoxins, microbial contamination, and other impurities that could interfere with cell-based or in vivo studies.





    Shop LL37 cosmetic peptides, freeze-dried powder, direct sale from the manufacturer.-Detailed Image 5



    Advantage  

     



    1. Ultra-High Purity

    Each batch is synthesized and purified to >99% purity, ensuring reliable and reproducible results in sensitive experiments.


    2.Accurate Dosing & Consistency
    Our peptides are precisely weighed and vacuum-sealed under sterile conditions. Batch-to-batch consistency is rigorously maintained.


    3.Endotoxin-Free & Sterile Processing
    Manufactured in a cleanroom environment, our peptides are free from endotoxins, microbial contamination, and other impurities that could interfere with cell-based or in vivo studies.



    Shop LL37 cosmetic peptides, freeze-dried powder, direct sale from the manufacturer.-Detailed Image 6


    FAQ


     

    Q1:Are you a supplier or a manufacturer?

    A:We are both a supplier and a manufacturer.

     

    Q2:How will you deliver the goods?

    A:We have strong cooperation with DHL, TNT, UPS, FEDEX, EMS, China Air Post. For container products, we can do sea shipping. You also can choose your own shipping forwarder.

     

    Q3:Which kind of payment terms do you accept?

    A:, Bitcoin, PayPal.USDT.

     

    Q4:How is the after-sales service?

    A:We will provide high-quality products and ensure 100% safe deliver.

     

    Q5:how can we guarantee quality?

    A:We will send you a COA (Certificate of Analysis) to you first for you to confirm the quality.

     

    Q6: How to confirm the Product Quality before placing orders?

    A:You can get free samples for some products, you only need to pay the shipping cost or arrange a courier to us and take the samples. You can send us your product specifications and requests,we will manufacture the products according to your requests.

     

    Q7:Is there any discount?

    A:Yes, for larger quantity, we always support with better pric e



     

    Shop LL37 cosmetic peptides, freeze-dried powder, direct sale from the manufacturer.-Detailed Image 7
    Shop LL37 cosmetic peptides, freeze-dried powder, direct sale from the manufacturer.-Detailed Image 8

     

     

    Why Choose Us:

     

     


    Fast Delivery: We ship your order quickly using DHL, FedEx, and other options. Most orders arrive in 5-15 days.

    Customs Clearance: No customs problems! We make sure your order is delivered smoothly.

    Easy Payment: Pay with Bitcoin,USDT,PAYAPL, or bank transfer.

    Good Quality: Our products are great, and we support small test orders.

     



    Company advantages

     


    Are you from these countries?United States, Canada, Spain, Portugal, Australia, Brazil, France, Netherlands, United Kingdom, Bulgaria, Norway, and more.

    Good News! We guarantee smooth customs clearance in key destinations, including Germany and Finland, with no issues at all. Your packages will be securely delivered within 5-15 days.




    Shop LL37 cosmetic peptides, freeze-dried powder, direct sale from the manufacturer.-Detailed Image 9
    Shop LL37 cosmetic peptides, freeze-dried powder, direct sale from the manufacturer.-Detailed Image 10



    Company Introduction






    Shanxi An Da Si Hai Technology Co., Ltd. is a professional manufacturer of various peptide products and chemical raw materials.

    We have a dedicated R&D team and a reliable, efficient logistics team to ensure you receive high-quality products safely and promptly.In order to serve customers well, the company has established special technical department and after-sale service department. Our customers come from countries including the United States, Europe,

    Europe, Japan, South Korea, and India. Most of our main products are in stock and ready for immediate shipment.  Please let us know the specific quantity you need.

    We will make careful reply if you get any question. We will satisfy market demands by top products and better service, and will welcome market challenge .We will offer you the most competitive price. Feel free to contact us for more information.




    Shop LL37 cosmetic peptides, freeze-dried powder, direct sale from the manufacturer.-Detailed Image 11
    Shop LL37 cosmetic peptides, freeze-dried powder, direct sale from the manufacturer.-Detailed Image 12

    Basic Info
    Product Name:

    LL-37

    Other Name:

    Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

    CAS No.:

    154947-66-7

    Molecular Formula:

    C205H340N60O53

    InChIKeys:

    POIUWJQBRNEFGX-XAMSXPGMSA-N

    Molecular Weight:

    0

    EC Number:

    211-519-9

    Color/Form:

    White to off-white

    Characteristics
    Water Solubility:

    Soluble to 1 mg/ml in water

  • Seller Information
    Business Type:

    Trader

    Main Products:

    Peptides

    Location:

    Shanxi An Da Si Hai Technology Co., Ltd.

    Payment Terms:

    TT against copy of documents,D/P,L/C,D/A,O/A,TT against B/L draft before shipment,100% TT in advance

    Total Annual Revenue:

    $2.5 million-$5 million

    Total Employees:

    Less than 5

    Year of Establishment:

    2025

  • Country Product Purchase Quantity Date Posted
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.