Product Description
GLP‑1 (Glucagon‑like Peptide 1, 1‑37, Human) is a 37‑amino‑acid synthetic peptide with the sequence: HDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG‑OH. Its molecular formula is C₁₈₆H₂₇₅N₅₁O₅₉, and its molecular weight is approximately 4167.03 g/mol.
As a full‑length incretin hormone, GLP‑1 acts as a highly potent agonist of the GLP‑1 receptor. Recent evidence has confirmed that GLP‑1 receptors are expressed in cutaneous tissues, opening new frontiers for topical cosmetic research. Unlike the popular truncated GLP‑1 analogues used in pharmaceuticals, the full‑length 1‑37 version offers distinct structural properties that make it a compelling candidate for advanced skincare formulation.
.
1. Ultra-High Purity
Each batch is synthesized and purified to >99% purity (HPLC), ensuring reliable and reproducible results in sensitive experiments.
2.Accurate Dosing & Consistency
Our peptides are precisely weighed and vacuum-sealed under sterile conditions. Batch-to-batch consistency is rigorously maintained.
3.Endotoxin-Free & Sterile Processing
Manufactured in a cleanroom environment, our peptides are free from endotoxins, microbial contamination, and other impurities that could interfere with cell-based or in vivo studies.
Sales manager: Eira
whatsapp:+8619304441463
whatsapp:+852 9546 9358
Email: sales01@cnspks.com
1. Advanced Manufacturing Capabilities
Cutting-Edge Facilities: High-precision equipment ensuring purity and bioactivity.
Scalable Production: From milligram-scale research peptides to multi-kilogram industrial batches.
2. Innovation & Customer Commitment
Reliable Supply Chain: Competitive pricing & timely global delivery.
Global Reach: Trusted by researchers, pharmaceutical firms & industrial clients worldwide.
Q1: May I get one sample before placing order?
Re: Yes, Sample are available. For normal products, samples are for free and you just need to bear the freight; For those high value products, you just need to freight and certain product cost. When we both cooperate for some times or when you are our VIP customer, free sample will be offered when you need.
Q2: Which payment is available for your company?
Re: T/T, PayPal,bank transfer etc. You can choose the one which is convenient for you.
Q3: How and when can I get my goods after payment?
Re: For small quantity products, they will be delivered to you by international courier(DHL, FedEx, TNT etc.) or by air. Usually it will cost 5-7days that you can get the goods after delivery.For large quantity products, shipping by see is worthwhile.It will cost 15 to 30 days to come to your destination port, which depends on where the port is.
Q4: Is there any possible to use my appointed label or package?
Re: Yes. If needed, we'd lik.
1. Expertise in Peptide Synthesis
Extensive Experience: 7 Years of expertise in synthetic peptide development.
Skilled Team: Experts in solid-phase and liquid-phase synthesis.
2. Advanced Manufacturing Capabilities
Cutting-Edge Facilities: High-precision equipment ensuring purity and bioactivity.
Scalable Production: From milligram-scale research peptides to multi-kilogram industrial batches.
3. Innovation & Customer Commitment
Reliable Supply Chain: Competitive pricing & timely global delivery.
Global Reach: Trusted by researchers, pharmaceutical firms & industrial clients worldwide.
4. Ultra-High Purity
Each batch is synthesized and purified to >99% purity (HPLC), ensuring reliable and reproducible results in sensitive experiments.
5.Accurate Dosing & Consistency
Our peptides are precisely weighed and vacuum-sealed under sterile conditions. Batch-to-batch consistency is rigorously maintained.
6.Endotoxin-Free & Sterile Processing
Manufactured in a cleanroom environment, our peptides are free from endotoxins, microbial contamination, and other impurities that could interfere with cell-based or in vivo studies.
Why Choose Our Peptides?
- Quality Assured: Sourced from trusted manufacturers with reliable global distribution, ensuring consistency and potency .
- Holistic Support: Complements weight management programs, metabolic health goals, and sleep apnea treatment plans—addressing root causes for lasting impact .
-
-
Why Partner with us?
Quality Assurance:
Manufactured in GMP-certified facilities with full traceability and regulatory-aligned documentation.
Flexible Supply:
Available in multiple formats. Consistent lead times with flexible production capacity.
Competitive Edge:
Factory-direct pricing with volume discounts; stable supply chain to meet your market demand.
Technical Support:
Full documentation and formulation guidance.