Product
Supplier
Encyclopedia
Inquiry
Home > Pharmaceutical Intermediates > Bulk Drug Intermediates > Glucagon for Sale > High-quality oxytocin 20mg 30mg peptide, glucagon acetate powder, CAS 16941-32-5, glucagon
High-quality oxytocin 20mg 30mg peptide, glucagon acetate powder, CAS 16941-32-5, glucagon buy - large image1
High-quality oxytocin 20mg 30mg peptide, glucagon acetate powder, CAS 16941-32-5, glucagon buy - image1
High-quality oxytocin 20mg 30mg peptide, glucagon acetate powder, CAS 16941-32-5, glucagon buy - image2
High-quality oxytocin 20mg 30mg peptide, glucagon acetate powder, CAS 16941-32-5, glucagon buy - image3
High-quality oxytocin 20mg 30mg peptide, glucagon acetate powder, CAS 16941-32-5, glucagon buy - image4
High-quality oxytocin 20mg 30mg peptide, glucagon acetate powder, CAS 16941-32-5, glucagon buy - image5
High-quality oxytocin 20mg 30mg peptide, glucagon acetate powder, CAS 16941-32-5, glucagon buy - image6

High-quality oxytocin 20mg 30mg peptide, glucagon acetate powder, CAS 16941-32-5, glucagon

TDS 4 Inquiries

Unit Price:

$35-40/UNIT FOB

Get Latest Price
CAS No.:

16941-32-5

Grade:

Pharmaceutical Grade

Content:

99%

Port:

hongkong

Brand:

Customized services available

Packaging:

20mg 30mg

Price valid (until):

2026-07-15

Company Type:
Trader
Location:
China
Qualification:
Main Products:

Retatrutide,Tirzepatide,GLOW,KLOW80,NAD+,TB500

  • Product Description

  • Seller Information

  • Inquiry History

  • Description


      Name: Nina
    Email: asdfg202620@outlook.com
    WhatsApp: +8613080411336


    Why choose us  
    1.  Well-equipped, stable and high-quality raw material supply chain, to provide customers with the best quality products.
    2.  Strict quality inspection process and professional certificate testing to ensure the quality level of the final product.

    3.  Excellent sales team can provide customers with integrated and professional services.

    4.  Accept various OEM & ODM services to meet the different needs of different customers,low MOQ.

    5.  Professional supplier and manufacturer, an integrated enterprise integrating production and sales, providing customers with one-stop service.
    FAQ 

    1.  Do you accept customization?
    RE: We can provide corresponding customized solutions according to the specific needs of customers.

    2.   Can you provide samples?

    RE: We can provide samples to customers and send them to consumers in time by express.

    3.  How is your production capacity ?and whether it can meet customer needs in a timely manner. RE:we can produce the products required by customers in time and have sufficient production capacity.

    4.  How long is your lead time?

    RE: Within 50kg, can be shipped within 5 days. More than 50 kg, the corresponding time needs to be negotiated according to the weight of the product.

    5.  What is your terms of payment ?

    RE: Payment<=1000USD, 100% in advance. Payment>=1000USD, 50% T/T in advance ,balance before shipment. irrevocable LC at sight.

    6.  Do you have OEM or ODM service of product?

    Re: Sure. If needed, we can customize products for you.

    7.  How can you guarantee the goods you offer is qualified ?

    Re: All the goods are inspected before shipment. If the goods can't come to the quality we promise, you can ask for refund.

    8.How will you deliver the goods?
    RE:We have strong cooperation with DHL, TNT, UPS, FEDEX, EMS, China Air Post. For container products, we can do sea shipping. You also can choose your own shipping forwarder.
    Company Profile

    Our company is a modern and advanced enterprise, specializing in the production and export of raw materials for drugs, drug intermediates, and plant extracts. Our products are widely used in the fields of medicine, medical health products, cosmetics, nutritional supplements, and food additives. Our factory covers an area of 95 acres. The proposed factory will comply with GMP standards. The factory environment is clean and tidy, with a reasonable layout, and includes large and medium-sized production workshops as well as shared workshops. It is equipped with advanced equipment, quality inspection and research centers. These products have reached the advanced domestic level in terms of quality and technical content. Since its establishment, the company has attached great importance to team training and technological reform. Our modern production equipment ensures the rapid and efficient production of the entire line, with high precision. All processing, extraction, packaging and transportation are completed internally, ensuring the highest quality and efficiency. We continuously develop new ingredients and innovative products, earning respect and praise from global customers. After years of continuous development, the company has accumulated rich experience in international trade and customer resources, established a stable customer base and a complete marketing service network. In addition, the company has established long-term technical cooperation relationships with experts and professors from many universities and research institutions in the province.

    Tirzepatide is a dual glucose-dependent insulinotropic polypeptide (GIP) and GLP-1 agonist that has been studied recently as a treatment for patients with noncirrhotic NASH (SYNERGY-NASH, NCT04166773) given its association with significant weight loss and improvement in features of metabolic syndrome in diabetes trials.

    Peptide

    Peptide products offer diverse functional benefits across multiple scenarios:


    in health management, peptides support metabolic regulation (aiding in blood sugar control and healthy weight management for specific groups) and immune system modulation by enhancing the body's defense responses; 


    in skincare, peptides promote skin barrier repair, boost collagen synthesis to reduce fine lines, and improve skin hydration and elasticity; 


    in sports nutrition, peptides assist in muscle recovery by reducing post-exercise tissue damage and supporting muscle protein Shop Chinese factories directly supply high-quality weight loss peptide Tirzepatide for global delivery.-Detailed Image 1 Shop Chinese factories directly supply high-quality weight loss peptide Tirzepatide for global delivery.-Detailed Image 2 Shop Chinese factories directly supply high-quality weight loss peptide Tirzepatide for global delivery.-Detailed Image 3 Shop Chinese factories directly supply high-quality weight loss peptide Tirzepatide for global delivery.-Detailed Image 4 Shop Chinese factories directly supply high-quality weight loss peptide Tirzepatide for global delivery.-Detailed Image 5 Shop Chinese factories directly supply high-quality weight loss peptide Tirzepatide for global delivery.-Detailed Image 6 Shop Chinese factories directly supply high-quality weight loss peptide Tirzepatide for global delivery.-Detailed Image 7 Shop Chinese factories directly supply high-quality weight loss peptide Tirzepatide for global delivery.-Detailed Image 8 Shop Chinese factories directly supply high-quality weight loss peptide Tirzepatide for global delivery.-Detailed Image 9 Shop Chinese factories directly supply high-quality weight loss peptide Tirzepatide for global delivery.-Detailed Image 10


    Items Specifications
    vial mg
    tude k
    bag kg

    Certificates
    • High-quality oxytocin 20mg 30mg peptide, glucagon acetate powder, CAS 16941-32-5, glucagon Certificates 1

    Basic Info
    Product Name:

    Glucagon

    Other Name:

    GLUCAGON 1-37;GLUCAGON (1-37) (PORCINE);GLUCAGON 37;GLUCAGON ACETATE;HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNKNNIA;H-HIS-SER-GLN-GLY-THR-PHE-THR-SER-ASP-TYR-SER-LYS-TYR-LEU-ASP-SER-ARG-ARG-ALA-GLN-ASP-PHE-VAL-GLN-TRP-LEU-MET-ASN-THR-LYS-ARG-ASN-LYS-ASN-ASN-ILE-ALA-OH;OXYNTOMODULIN (PORCINE);OXYNTOMODULIN

    CAS No.:

    16941-32-5

    Molecular Formula:

    C153H225N43O49S

    InChIKeys:

    MASNOZXLGMXCHN-ZLPAWPGGSA-N

    Molecular Weight:

    3482.75

    Exact Mass:

    3480.615723

    EC Number:

    232-708-2

    HScode:

    2937190000

    Characteristics
    PSA:

    1564.04000

    XLogP3:

    -6.01

    Appearance:

    powder

    Density:

    1.53±0.1 g/cm3(Predicted)

    Refractive Index:

    1.682

    Water Solubility:

    Practically insoluble in water and in most organic solvents. It is soluble in dilute mineral acids and in dilute solutions of alkali hydroxides.

    Storage Conditions:

    −20°C

    Hazard Identification

    Classification of the substance or mixture

    Skin sensitization, Category 1

    Acute toxicity - Category 4, Inhalation

    Respiratory sensitization, Category 1

    GHS label elements, including precautionary statements

    Pictogram(s)
    Signal word

    Danger

    Hazard statement(s)

    H317 May cause an allergic skin reaction

    H332 Harmful if inhaled

    H334 May cause allergy or asthma symptoms or breathing difficulties if inhaled

    Precautionary statement(s)
    Prevention

    P261 Avoid breathing dust/fume/gas/mist/vapours/spray.

    P272 Contaminated work clothing should not be allowed out of the workplace.

    P280 Wear protective gloves/protective clothing/eye protection/face protection/hearing protection/...

    P271 Use only outdoors or in a well-ventilated area.

    P284 [In case of inadequate ventilation] wear respiratory protection.

    Response

    P302+P352 IF ON SKIN: Wash with plenty of water/...

    P333+P317 If skin irritation or rash occurs: Get medical help.

    P321 Specific treatment (see ... on this label).

    P362+P364 Take off contaminated clothing and wash it before reuse.

    P304+P340 IF INHALED: Remove person to fresh air and keep comfortable for breathing.

    P317 Get medical help.

    P342+P316 If experiencing respiratory symptoms: Get emergency medical help immediately.

    Storage

    none

    Disposal

    P501 Dispose of contents/container to an appropriate treatment and disposal facility in accordance with applicable laws and regulations, and product characteristics at time of disposal.

    Other hazards which do not result in classification

    no data available

    Handling and Storage

    Precautions for safe handling

    Handling in a well ventilated place. Wear suitable protective clothing. Avoid contact with skin and eyes. Avoid formation of dust and aerosols. Use non-sparking tools. Prevent fire caused by electrostatic discharge steam.

    Conditions for safe storage, including any incompatibilities

    Store the container tightly closed in a dry, cool and well-ventilated place. Store apart from foodstuff containers or incompatible materials.

  • Seller Information
    Business Type:

    Trader

    Main Products:

    Retatrutide,Tirzepatide,GLOW,KLOW80,NAD+,TB500

    Location:

    Room 11B, Building 0056, No. 81-1 Nonglinxia Road, Yuexiu District, Guangzhou City, Guangdong Province

    Total Annual Revenue:

    $1 million-$2.5 million

    Total Employees:

    5-10

    Year of Establishment:

    2026

  • Inquiry History
    4 Inquiries
    Country Product Purchase Quantity Date Posted
    Belgium

    Glucagon 16941-32-5 Pharmaceutical grade

    10 PCS Jan 8, 2026
    Belgium

    Glucagon (1-29)

    5 MG Jan 9, 2026
    Netherlands

    glucagon

    1000 KG Feb 15, 2024
    Bulgaria

    Glucagon, not retatrutide, just glucagon

    1 G May 10, 2026
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.