Product
Supplier
Encyclopedia
Inquiry
Home > Biochemical Engineering > Polypeptide > LL-37 for Sale > LL-37 Synthetic Cathelicidin Peptide Raw Reagent For In Vitro Research Work
LL-37 Synthetic Cathelicidin Peptide Raw Reagent For In Vitro Research Work buy - large image1
LL-37 Synthetic Cathelicidin Peptide Raw Reagent For In Vitro Research Work buy - image1
LL-37 Synthetic Cathelicidin Peptide Raw Reagent For In Vitro Research Work buy - image2
LL-37 Synthetic Cathelicidin Peptide Raw Reagent For In Vitro Research Work buy - image3
LL-37 Synthetic Cathelicidin Peptide Raw Reagent For In Vitro Research Work buy - image4
LL-37 Synthetic Cathelicidin Peptide Raw Reagent For In Vitro Research Work buy - image5
LL-37 Synthetic Cathelicidin Peptide Raw Reagent For In Vitro Research Work buy - image6

LL-37 Synthetic Cathelicidin Peptide Raw Reagent For In Vitro Research Work

TDS 1 Inquiries

Unit Price:

$80/UNIT FOB

Get Latest Price
CAS No.:

154947-66-7

Grade:

Pharmaceutical Grade

Content:

99%

Port:

Guangdong

Brand:

band

Packaging:

10 pieces per box

Price valid (until):

2027-09-27

Company Type:
Trader
Location:
Hongkong, China
Qualification:
Main Products:

Tirzepatide,Retatrutide,Semaglutide,GHK-Cu

  • Product Description

  • Seller Information

  • Inquiry History

  • Description


      Product Detail  


    This synthetic peptide material is supplied as white lyophilized powder. Adopting professional freeze-drying technology, it owns stable physical and chemical properties and steady quality across different batches.
    Tested by HPLC, its purity reaches over 99%, fully meeting the quality requirements for professional scientific research. The lyophilized form effectively slows down substance deterioration and maintains long-term stability. It has favorable solubility and can be well dissolved in conventional laboratory aqueous solvents and buffer solutions.
    Strict quality inspection is carried out for every batch, with complete test records available for traceability. The product is widely applied in cell research, biochemistry and other life science experimental fields. All content is for research reference only, without any functional claims.

    Disclaimer

    This product is exclusively for scientific research in professional laboratories. It is forbidden to use it for human or animal diagnosis, treatment, as well as the production of food, cosmetics, pharmaceuticals and other non-research products. Users shall abide by local relevant laws and regulations and take full responsibility for standardized operation.
    • High purity up to 99% via HPLC detection, conforming to lab research standards
    • Lyophilized form ensures excellent stability during storage and use
    • Good solubility, compatible with most common lab solvents and buffers
    • Rigorous quality control, complete certification documents provided
    • Low moisture content, easy for daily storage and transportation
      This product is for laboratory research use only. Prepare corresponding aqueous solvent or buffer according to experimental demands. Add solvent slowly and mix gently until the powder is fully dissolved; do not shake violently. The material is hygroscopic, please finish preparation quickly and reduce contact with air. It is suggested to prepare the solution right before experiments. Seal the remaining solution tightly and store at 2–8°C for prompt use. All operations need to be completed by professional researchers in a standard laboratory.
      Keep the container tightly sealed. For long-term storage, place in a dry and dark environment at -20°C, and avoid repeated freeze-thaw cycles. After opening, store at 2–8°C and use within 3 months. Room temperature transportation is allowed. Since the product is hygroscopic, please keep it away from moist surroundings.

    Items Specifications
    CAS No 154947-66-7
    Product Name LL37
    Appearance White lyophilized powder
    Specification 10 pieces per box
    Origin Guangzhou
    Purity ≥98% HPLC
    Storage Keep sealed, cool, dry and away from light

    Shop 5-Amino-1MQ (CAS 42464-96-0)-Detailed Image 1
    Shop 5-Amino-1MQ (CAS 42464-96-0)-Detailed Image 2
    Shop 5-Amino-1MQ (CAS 42464-96-0)-Detailed Image 3

    Shop Research Grade Kisspeptin-10 Lyophilized Powder, Laboratory Biochemical Research Material-Detailed Image 4 Shop Research Grade Kisspeptin-10 Lyophilized Powder, Laboratory Biochemical Research Material-Detailed Image 5 Shop Melanotan I CAS 75921-69-6 Research Grade Synthetic Peptide Powder-Detailed Image 6 Shop Melanotan I CAS 75921-69-6 Research Grade Synthetic Peptide Powder-Detailed Image 7 Shop Melanotan I CAS 75921-69-6 Research Grade Synthetic Peptide Powder-Detailed Image 8


      Usage Method  


                    1. Full Version

                      This lyophilized powder is for laboratory research use only. Prepare the corresponding aqueous solvent or buffer according to your experimental requirements. Add the solvent slowly and mix gently until the powder is fully dissolved; do not shake vigorously. The material is hygroscopic, so please complete the preparation quickly and minimize contact with air. It is recommended to prepare the solution immediately before the experiment. Seal any remaining solution tightly and store at 2–8°C for prompt use. All operations must be performed by professional researchers in a standard laboratory environment.
                      Concise Version

                      Dissolve with lab solvent or buffer and mix gently. Avoid violent shaking. Minimize air exposure. Store residual solution at 2–8°C. For research use only.
    Shop 5-Amino-1MQ (CAS 42464-96-0)-Detailed Image 5
    Shop 5-Amino-1MQ (CAS 42464-96-0)-Detailed Image 6
    Shop 5-Amino-1MQ (CAS 42464-96-0)-Detailed Image 7
    Shop 5-Amino-1MQ (CAS 42464-96-0)-Detailed Image 8 Shop Cagrilintide High Purity Research Grade Peptide Raw Material-Detailed Image 13 Shop Cagrilintide High Purity Research Grade Peptide Raw Material-Detailed Image 14 Shop Cagrilintide High Purity Research Grade Peptide Raw Material-Detailed Image 15 Shop Cagrilintide High Purity Research Grade Peptide Raw Material-Detailed Image 16 Shop Cagrilintide High Purity Research Grade Peptide Raw Material-Detailed Image 17


      Storage Guidelines  


                    1. Full Version

                      Keep the vial tightly sealed at all times. For long-term storage, place it in a dry, dark environment at -20°C and avoid repeated freeze-thaw cycles to maintain stability. After opening, store at 2–8°C and use within 3 months. Room temperature transportation is acceptable, but please transfer to the recommended storage conditions immediately upon receipt. The product is hygroscopic, so take care to protect it from moisture and high humidity.
                      Concise Version

                      Seal tightly. Long-term storage: -20°C, dry and dark, avoid freeze-thaw cycles. After opening: 2–8°C, use within 3 months. Protect from moisture.
    Shop 5-Amino-1MQ (CAS 42464-96-0)-Detailed Image 9
    Shop 5-Amino-1MQ (CAS 42464-96-0)-Detailed Image 10
    Shop 5-Amino-1MQ (CAS 42464-96-0)-Detailed Image 11
    Shop 5-Amino-1MQ (CAS 42464-96-0)-Detailed Image 12 Shop Thymosin Alpha-1 Synthetic Polypeptide Lyophilized Powder CAS 62304-98-7 For Laboratory Research Only-Detailed Image 14 Shop Thymosin Alpha-1 Synthetic Polypeptide Lyophilized Powder CAS 62304-98-7 For Laboratory Research Only-Detailed Image 15


     Hong Kong Bosen Peptide R&D Co., Limited


    Hong Kong Bosen Peptide R&D Co., Limited is a professional biotechnology company headquartered in Hong Kong, with a focus on peptide research, development, production and global supply. Rooted in the Greater Bay Area’s strong biotech ecosystem, we integrate cutting-edge R&D capabilities, strict quality control systems and efficient global logistics to deliver high-quality peptide products and technical solutions to customers worldwide.

    Core Business & Product Portfolio


    We specialize in the R&D, customization and commercial production of high-purity peptides, modified peptides and related biotech raw materials. Our product portfolio covers:

    • Therapeutic peptides: SS-31 (Elamipretide), Tirzepatide, Semaglutide, Retatrutide (RT20), etc.
    • Functional peptides: GHK-Cu, TB500, KPV, NAD, Glutathione, etc.
    • Custom peptide services: Custom synthesis of complex sequences, long-chain peptides (up to 200 amino acids) and cyclic peptides, as well as various modification services (N-methylation, unusual amino acid incorporation, etc.).

    R&D & Manufacturing Strength


    • Technical expertise: Mastery of core technologies including solid-phase peptide synthesis (SPPS), liquid-phase synthesis, advanced purification (HPLC) and strict structural characterization.
    • Quality assurance: All products are produced in compliance with cGMP standards, with complete CoA, HPLC and MS reports to ensure batch-to-batch consistency and high purity (≥98%).
    • Production capacity: Equipped with professional production bases in Guangzhou, supporting small-batch R&D samples to large-scale commercial production, with stable supply capacity.

    Global Market & Service Philosophy


    With a customer base spanning the Philippines, the United States, Brazil, Russia, Bangladesh and other regions, we adhere to the service philosophy of "Quality First, Customer Centric". We provide one-stop services including product consultation, customization, technical support and global logistics solutions (door-to-door delivery, customs clearance assistance), committed to becoming a reliable long-term partner for global biotech enterprises, research institutions and health industry clients.

    Vision


    We are dedicated to advancing peptide technology innovation, expanding the application of peptides in health and medical fields, and contributing to global human health with high-quality products and professional services.
    Shop 5-Amino-1MQ (CAS 42464-96-0)-Detailed Image 13
    Shop 5-Amino-1MQ (CAS 42464-96-0)-Detailed Image 14
    Shop Research Grade IGF-1 LR3 Lyophilized Powder, Laboratory Biochemical Reagent-Detailed Image 15
    Shop Kisspeptin-10 Synthetic Polypeptide Lyophilized Powder For Laboratory Scientific Research Only-Detailed Image 19


    Certificates
    • LL-37 Synthetic Cathelicidin Peptide Raw Reagent For In Vitro Research Work Certificates 1

    Basic Info
    Product Name:

    LL-37

    Other Name:

    Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

    CAS No.:

    154947-66-7

    Molecular Formula:

    C205H340N60O53

    InChIKeys:

    POIUWJQBRNEFGX-XAMSXPGMSA-N

    Molecular Weight:

    0

    EC Number:

    211-519-9

    Color/Form:

    White to off-white

    Categories:

    Polypeptide

    Characteristics
    Water Solubility:

    Soluble to 1 mg/ml in water

  • Seller Information
    Business Type:

    Trader

    Main Products:

    Tirzepatide,Retatrutide,Semaglutide,GHK-Cu

    Location:

    RM 701, UNIT 108, 7/F, TWR B NEW MANDARIN PLAZA 14 SCIENCE MUSEUM RD TSIM SHA TSUI HONG KONG

    Year of Establishment:

    2026

  • Inquiry History
    1 Inquiries
    Country Product Purchase Quantity Date Posted
    Indonesia

    LL-37

    5 MG Jun 23, 2026
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.