 Home > Active Pharmaceutical Ingredients > Other Chemical Drugs > LL-37 for Sale > 375-High purity, large quantity, discounted price. Direct delivery from the manufacturer.

375-High purity, large quantity, discounted price. Direct delivery from the manufacturer. buy - large image1

375-High purity, large quantity, discounted price. Direct delivery from the manufacturer. buy - image1

375-High purity, large quantity, discounted price. Direct delivery from the manufacturer. buy - image2

375-High purity, large quantity, discounted price. Direct delivery from the manufacturer. buy - image3

375-High purity, large quantity, discounted price. Direct delivery from the manufacturer. buy - image4

375-High purity, large quantity, discounted price. Direct delivery from the manufacturer.

TDS 1 Inquiries

Unit Price:

$1-1.3/MT FOB

Get Latest Price 

CAS No.:

154947-66-7

Grade:

Pharmaceutical Grade

Content:

99.9%

Port:

SHENZHEN

Brand:

CUSTOM-MADE

Packaging:

10 pieces per box

Price valid (until):

2026-10-13

Contact Supplier

 Chat Now

Hong Kong Biopetide Research Limited

Company Type:

Trader

Location:

Hongkong, China

Qualification:

Main Products:

polypeptide,GHK-CU,NAD+,Tirzepatide,GLutathione

 Visit Store

Product Description
Seller Information
Inquiry History

Description

Product Detail

WHATSAPP+85265540844

Product Detail

LL-37 is the only human cathelicidin antimicrobial peptide, a 37-residue cationic peptide derived from hCAP18. It exhibits broad-spectrum antimicrobial activity against Gram-positive/negative bacteria, fungi, and enveloped viruses, with low resistance risk. It modulates immune cell chemotaxis, cytokine release, and inflammation. It promotes angiogenesis and wound healing, and inhibits tumor growth. For research & cosmetic use only. Store at -20°C with cold-chain transport.

About US

Q1: Has your product quality been certified by third-party laboratories?

A: Yes. All our products have undergone rigorous testing by our quality control department, been verified by the quality assurance team, and approved by third-party laboratories in China. By choosing us, you are guaranteed to receive high-quality products.

Q2: How do we cooperate with you?

A: You can contact us via the information on our website to initiate cooperation, or reach out directly to our sales team. We will then communicate all specific details with you via email.

Q3: Do you offer discounts?

A: Yes. We always offer more favorable prices for large-volume orders.

Q4: What payment options are available?

A: US customers can pay via Chime and Venmo. But we mainly recommend: USDT, BTC, MoneyGram, Wise and Alipay.

Q5: How long does it take for the goods to arrive?

A: It depends on your location. For small orders, delivery via DHL, UPS, TNT, FedEx or EMS usually takes 5-7 days. For bulk orders, air freight takes 5-8 days, while sea freight takes 20-35 days.

Q6: Can I get a sample before placing an order?

A: Yes,

We can provide samples if necessary.

Q7: Do you have a return and reshipment policy?

A: We have comprehensive after-sales service and a reshipment policy for lost packages. We highly value long-term cooperation with our customers. We take great care in product packaging, and our customers can attest to this—even when locating products is difficult, our packaging ensures they are easy to identify. Despite our best efforts, a small number of packages may still be lost. In such cases, we promise to reship the goods free of charge to build a long-term partnership with you.

Shipping&Packaging

We mainly adopt special line logistics and FedEx transportation methods. It can fully guarantee shipping timeliness, fast delivery, stable logistics track, safe and on-time arrival.

Basic Info

Items	Specifications
Category	Peptides
Purpose	Weight Loss
Purity	99.14%
Specification	10mg 50mg
Storage	Dry Cool Sealed Container
Origin	China

Certificates

Basic Info

Product Name:

LL-37

Other Name:

Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

CAS No.:

154947-66-7

Molecular Formula:

C205H340N60O53

InChIKeys:

POIUWJQBRNEFGX-XAMSXPGMSA-N

Molecular Weight:

EC Number:

211-519-9

Color/Form:

White to off-white

Categories:

Other Chemical Drugs

Characteristics

Water Solubility:

Soluble to 1 mg/ml in water

Seller Information

Business Type:
Trader

Main Products:
polypeptide,GHK-CU,NAD+,Tirzepatide,GLutathione

Location:
Room 5003, 5/F, Lee Yu Centre, 45 Hoi Yuen Road, Kwun Tong, Hong Kong

Year of Establishment:
2026

Inquiry History

1 Inquiries

Country	Product	Purchase Quantity	Date Posted
Indonesia	LL-37	5 MG	Jun 23, 2026

Post an enquiry for this product

More Choices Find All Products for Sale 

Product Name	Grade / Content	Price	Supplier Name	Details
LL37 \| US Warehouse \| Cosmetic Peptides \| 99% Purity \| 5mg 10mg Vials \| Lyophilized Powder	Pharma Grade / Research Grade/99	$20-23/G FOB	Tianjin Huifeng Technology Co., Ltd.	Inquiry
Pharmaceutical Grade Peptide ll37 Powder 5mg LL37 CAS 154947-66-7 LL-37 Customizable	Pharmaceutical Grade/99	$1.2-1.3/UNIT FOB	Guangzhou Duo Run Trading	Inquiry
Factory wholesales peptides 154947-66-7 LL37 5mg Peptide with high quatity 20mg	Pharmaceutical Grade/99	$50/MT FOB	Changsha Caoquan	Inquiry
LL37 Fast delivery High purity Weight loss peptide Safe transportation	Pharmaceutical Grade/99	$20-25/G FOB	Shanxi Andashihai Technology Co., Ltd.	Inquiry
LL37 CAS 154947-66-7 \| Antibacterial Activity & Immune Research Raw Material	Pharmaceutical Grade/99		Tranmoo	Inquiry

375-High purity, large quantity, discounted price. Direct delivery from the manufacturer.

Product Description

Seller Information

Inquiry History

More Choices Find All Products for Sale 

Related Searches