Product
Supplier
Encyclopedia
Inquiry
Home > Cosmetic Ingredient > Oxidising > LL-37 for Sale > MS10 MS40 322 ET10 ET50 CAS682809-81-0 Inventory is sufficient
MS10 MS40 322  ET10 ET50 CAS682809-81-0 Inventory is sufficient buy - large image1
MS10 MS40 322  ET10 ET50 CAS682809-81-0 Inventory is sufficient buy - image1
MS10 MS40 322  ET10 ET50 CAS682809-81-0 Inventory is sufficient buy - image2
MS10 MS40 322  ET10 ET50 CAS682809-81-0 Inventory is sufficient buy - image3
MS10 MS40 322  ET10 ET50 CAS682809-81-0 Inventory is sufficient buy - image4
MS10 MS40 322  ET10 ET50 CAS682809-81-0 Inventory is sufficient buy - image5
MS10 MS40 322  ET10 ET50 CAS682809-81-0 Inventory is sufficient buy - image6

MS10 MS40 322 ET10 ET50 CAS682809-81-0 Inventory is sufficient

TDS

Unit Price:

$1/G FOB

Get Latest Price
CAS No.:

154947-66-7

Grade:

Pharmaceutical Grade

Content:

99%

Port:

shenzhen

Brand:

sc

Packaging:

5 mg /10 mg / 15 mg / 20 mg / 30 mg / 10 tubes per box

Price valid (until):

2026-12-10

Company Type:
Trader
Location:
Hongkong, China
Qualification:
Main Products:

tr

  • Product Description

  • Seller Information

  • Description


      Product Detail  


    Business Manager: Hailey
    WhatsApp: +852 7056 3242

    Shop SLU-PP-322 IP10 MS10 MS40 322  ET10 ET50 CAS154947-66-7 The price is the factory price-Detailed Image 1
    Items Specifications
    Product name SLU-PP-322
    CAS NO. 303760-60-3
    Purity 99%
    Shop SLU-PP-322 IP10 MS10 MS40 322  ET10 ET50 CAS154947-66-7 The price is the factory price-Detailed Image 8


              Our team of experienced professionals is committed to delivering innovative solutions and exceptional customer service.

    We work closely with our clients to understand their unique needs and develop customized products to meet their specific requirements.

    With a state-of-the-art manufacturing facility and strict quality control measures,

    we ensure that our products meet the highest standards of safety and purity.

    At HuBei bocare Chem Co., Ltd., we are dedicated to promoting a healthy lifestyle and providing our customers with

    the tools they need to achieve their wellness goals. Whether you are looking to improve your energy levels, support your immune system,

    or enhance your overall health, we have a range of products to meet your needs. We are committed to excellence in everything we do and

    look forward to working with you to achieve your health and wellness goals.

    Shop SLU-PP-322 IP10 MS10 MS40 322  ET10 ET50 CAS154947-66-7 The price is the factory price-Detailed Image 9
               Please note the following points when storing peptides:
                        - Store peptides in a cool, dry and dark environment
                        - Avoid repeated freezing and thawing of peptides
                        - Prevent peptides from being overexposed to air
                        - Protect peptides from light
                        - Do not store peptides in solution for a long time
                        - Aliquot peptides according to specific experimental requirements


    Shop SLU-PP-322 IP10 MS10 MS40 322  ET10 ET50 CAS154947-66-7 The price is the factory price-Detailed Image 10
     We are dedicated to providing high-quality peptides at affordable prices. Our products are produced quickly and safely. Provide samples before regular order. And our products have been spread across Europe, South America, North America, Southeast Asia, Africa and more countries in the world.In order to serve customers well, the company has established special technical department and after-sale service department. We will make careful reply if you get any question.
    Shop LC600 CBL60 5AD SMO5 SMO10 CAS868844-74-0 Quick inventory delivery-Detailed Image 9

    lntroduce

              Our products enjoy good reputation both at home and abroad. Our trade partners are around the world, mainly in America,Europe,Australia,South East Asia ,Middle East and South Africa. In order to serve customers well, the company has established special technical department and after-sale service department. We will make careful reply if you get any question.

              The company with all the employees will constantly purse excellent quality, perfect brand and our image, and adheres to our spirit of honesty, diligence, seeking truth and progress and insists on business philosophy of quality as life and service as soul. We will satisfy market demands by top products and better service, and will welcome market challenge forever.

    Shop LC600 CBL60 5AD SMO5 SMO10 CAS868844-74-0 Quick inventory delivery-Detailed Image 10

    1. Ultra-High Purity
    Each batch is synthesized and purified to >99% purity (HPLC), ensuring reliable and reproducible results in sensitive experiments.

    2.Accurate Dosing & Consistency
    Our peptides are precisely weighed and vacuum-sealed under sterile conditions. Batch-to-batch consistency is rigorously maintained.

    3.Endotoxin-Free & Sterile Processing
    Manufactured in a cleanroom environment, our peptides are free from endotoxins, microbial contamination, and other impurities that could interfere with cell-based or in vivo studies.

    4. Advanced Manufacturing Capabilities

    Cutting-Edge Facilities: High-precision equipment ensuring purity and bioactivity.

    Scalable Production: From milligram-scale research peptides to multi-kilogram industrial batches.

    5. Innovation & Customer Commitment

    Reliable Supply Chain: Competitive pricing & timely global delivery.

    Global Reach: Trusted by researchers, pharmaceutical firms & industrial clients worldwide.

    Shop SMO5 SMO10 KS5 KS10 BB10 CAS67727-97-3 Overseas warehouse delivery-Detailed Image 9
    1.We are very experienced with this field(more than 10 years);
    2.Good after-sales service
    3.100% quality guaranteed;
    4.We accept sample order for testing;
    5.Strong supply ability
    Shop SMO5 SMO10 KS5 KS10 BB10 CAS67727-97-3 Overseas warehouse delivery-Detailed Image 10
    Shop MS10 MS40 322  ET10 ET50 CAS682809-81-0 Inventory is sufficient-Detailed Image 9
    Shop MS10 MS40 322  ET10 ET50 CAS682809-81-0 Inventory is sufficient-Detailed Image 10

    Certificates
    • MS10 MS40 322  ET10 ET50 CAS682809-81-0 Inventory is sufficient Certificates 1

    Basic Info
    Product Name:

    LL-37

    Other Name:

    Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

    CAS No.:

    154947-66-7

    Molecular Formula:

    C205H340N60O53

    InChIKeys:

    POIUWJQBRNEFGX-XAMSXPGMSA-N

    Molecular Weight:

    0

    EC Number:

    211-519-9

    Color/Form:

    White to off-white

    Categories:

    Oxidising

    Characteristics
    Water Solubility:

    Soluble to 1 mg/ml in water

  • Seller Information
    Business Type:

    Trader

    Main Products:

    tr

    Location:

    B27 SHING LEE COMM BLDG 8WING KUT ST CENTRAL HONGKONG

    Average lead Time:

    1

    Total Annual Revenue:

    Less than $1 million

    Total Employees:

    5-10

    Year of Establishment:

    2026

    20 years of production experience in peptide products

    Safe and unobstructed shipping channels|High quality guaranteed|

    Our company is located in Guangzhou, China. Its production facilities are situated in a modern 5,000-square-meter factory. As a private enterprise, we have over 200 professional employees and are actively expanding our team to support future growth. Over the past two decades, as a comprehensive enterprise integrating research, production, processing and export in the chemical industry, we have performed exceptionally well. Since our establishment, we have always adhered to the principles of "honest management, strict quality control, and customer-oriented service", and have received continuous praise from global customers. Our company is a Chinese manufacturer of peptide products, guaranteeing product quality and effectiveness at affordable prices. We offer reliable and secure shipping channels with discreet delivery to ensure safe and timely arrival.


  • Country Product Purchase Quantity Date Posted
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.