Product
Supplier
Encyclopedia
Inquiry
Home > Cosmetic Ingredient > Absorbent > LL-37 for Sale > MS40 MOTS-c IP5 IP10 MS10 CAS67727-97-3 High-quality peptide-based drugs
MS40 MOTS-c IP5 IP10 MS10 CAS67727-97-3 High-quality peptide-based drugs buy - large image1
MS40 MOTS-c IP5 IP10 MS10 CAS67727-97-3 High-quality peptide-based drugs buy - image1
MS40 MOTS-c IP5 IP10 MS10 CAS67727-97-3 High-quality peptide-based drugs buy - image2
MS40 MOTS-c IP5 IP10 MS10 CAS67727-97-3 High-quality peptide-based drugs buy - image3
MS40 MOTS-c IP5 IP10 MS10 CAS67727-97-3 High-quality peptide-based drugs buy - image4
MS40 MOTS-c IP5 IP10 MS10 CAS67727-97-3 High-quality peptide-based drugs buy - image5
MS40 MOTS-c IP5 IP10 MS10 CAS67727-97-3 High-quality peptide-based drugs buy - image6

MS40 MOTS-c IP5 IP10 MS10 CAS67727-97-3 High-quality peptide-based drugs

TDS 1 Inquiries

Unit Price:

$1/G FOB

Get Latest Price
CAS No.:

154947-66-7

Grade:

Pharmaceutical Grade

Content:

99%

Port:

shenzhen

Brand:

sc

Packaging:

5 mg /10 mg / 15 mg / 20 mg / 30 mg / 10 tubes per box

Price valid (until):

2027-01-13

Company Type:
Trader
Location:
Hongkong, China
Qualification:
Main Products:

tr

  • Product Description

  • Seller Information

  • Inquiry History

  • Description


      Product Detail  


    Business Manager: Hailey
    WhatsApp: +852 7056 3242

    Shop Adipotide G65 G610 wu AP5 G5K G10K CAS154947-66-7 High purity and prompt delivery-Detailed Image 3

    Why Choose Our Peptides?

    •             Clinically Relevant: Aligns with global trends in peptide therapeutics.
    •             Quality Assured: Sourced from trusted manufacturers with reliable global distribution, ensuring consistency and potency .
    •             Holistic Support: Complements weight management programs, metabolic health goals, and sleep apnea treatment plans—addressing root causes for lasting impact .
    Shop Adipotide G65 G610 wu AP5 G5K G10K CAS154947-66-7 High purity and prompt delivery-Detailed Image 4

    Q1.Can I have a sample order?

    A: Yes, welcome to place an sample order to check quality or market.

    Q2.What's the sample and goodslead time?

    A:The stock sample for l day,custom sample for 7-10 days,bulk order for 20-25 days.

    Q3.Do you have any MOQ limit?

    A:yes,the MOQ is 100pcs but any trial order is welcome.

    Q4.How do you ship the goods and how long does it take to arrive?

    A:According to your order quantity,usually ship by sea or by air and by express,20-30 days by sea,5-7 days by air and 3-5 days byexpress.

    Q5.How to proceed an order?

    A: Firstly let us know your requirements. Secondly We quote according to your requirements or our suggestions. Thirdly customer confirm the artworks and pay deposit for formal order.Fourthly We arrange the production & shipment then you pay balance to us.

    Q6.Is it OK to print my logo on the product?

    A: Yes.Please provide the logo Al file so that our designer can make the mock up for you approval.

    Q7: Can you support custom packing?

    A: Sure,custom poly bag with warning text,gift box or display box is welcome.es.

    Shop Adipotide G65 G610 wu AP5 G5K G10K CAS154947-66-7 High purity and prompt delivery-Detailed Image 5                         1.We are very experienced with this field(more than 10 years);
                             2.Good after-sales service
                             3.100% quality guaranteed;
                             4.We accept sample order for testing;
                             5.Strong supply ability
    Shop Adipotide G65 G610 wu AP5 G5K G10K CAS154947-66-7 High purity and prompt delivery-Detailed Image 6             Our production process adheres to strict quality control protocols, from raw material sourcing to final product packaging. With a team of experienced scientists and technicians, we can customize peptide sequences according to specific client requirements, providing tailor - made solutions for diverse industries. Our commitment to innovation, reliability, and customer satisfaction makes us the preferred partner for all your peptide manufacturing needs.
    Shop Adipotide G65 G610 wu AP5 G5K G10K CAS154947-66-7 High purity and prompt delivery-Detailed Image 7

                  ey Specifications/ Special Features:
                            As a leading peptide manufacturing powerhouse, we specialize in producing high - quality peptides with unmatched precision and consistency. Our state - of - the - art facilities are equipped with advanced synthesis and purification technologies, ensuring that each peptide product meets the highest industry standards. Whether it's pharmaceutical - grade peptides for research and development, functional peptides for nutraceuticals, or cosmeceutical peptides for skincare applications, we offer a comprehensive range of solutions.

                             We also offer a wide variety of peptide types, such as oligopeptides, polypeptides, and modified peptides. Oligopeptides, with their small molecular size, are highly absorbable and ideal for applications where rapid penetration and bioavailability are crucial, like in dietary supplements aimed at boosting immune function or promoting muscle recovery. Polypeptides, on the other hand, are well - suited for complex biological functions and are frequently used in the development of therapeutic drugs. Modified peptides, which can be customized with specific chemical groups, open up new possibilities for targeted drug delivery and enhanced stability.

    Shop Adipotide G65 G610 wu AP5 G5K G10K CAS154947-66-7 High purity and prompt delivery-Detailed Image 8

                                         ----- Peptide Storage Guidelines: General Tips-----

                          When storing peptides, remember to:
                                 • Store peptide in a cold, dry, dark place
                                 • Avoid repeated freezing and thawing of peptide
                                 • Avoid overexposure to the air
                                 • Avoid light exposure
                                 • Avoid storing peptides in solution long term
                                 • Aliquot peptide according to experimental requirement

    Shop Adipotide G65 G610 wu AP5 G5K G10K CAS154947-66-7 High purity and prompt delivery-Detailed Image 9

    ------Peptide------

                  Peptide products offer diverse functional benefits across multiple scenarios:


                  in health management, peptides support metabolic regulation (aiding in blood sugar control and healthy weight management for specific groups) and immune system modulation by enhancing the body's defense responses; 


                  in skincare, peptides promote skin barrier repair, boost collagen synthesis to reduce fine lines, and improve skin hydration and elasticity; 


                  in sports nutrition, peptides assist in muscle recovery by reducing post-exercise tissue damage and supporting muscle protein synthesis.

    Shop Adipotide G65 G610 wu AP5 G5K G10K CAS154947-66-7 High purity and prompt delivery-Detailed Image 10
    Shop MS40 MOTS-c IP5 IP10 MS10 CAS67727-97-3 High-quality peptide-based drugs-Detailed Image 9
    Shop MS40 MOTS-c IP5 IP10 MS10 CAS67727-97-3 High-quality peptide-based drugs-Detailed Image 10

    Certificates
    • MS40 MOTS-c IP5 IP10 MS10 CAS67727-97-3 High-quality peptide-based drugs Certificates 1

    Basic Info
    Product Name:

    LL-37

    Other Name:

    Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

    CAS No.:

    154947-66-7

    Molecular Formula:

    C205H340N60O53

    InChIKeys:

    POIUWJQBRNEFGX-XAMSXPGMSA-N

    Molecular Weight:

    0

    EC Number:

    211-519-9

    Color/Form:

    White to off-white

    Categories:

    Absorbent

    Characteristics
    Water Solubility:

    Soluble to 1 mg/ml in water

  • Seller Information
    Business Type:

    Trader

    Main Products:

    tr

    Location:

    B27 SHING LEE COMM BLDG 8WING KUT ST CENTRAL HONGKONG

    Average lead Time:

    1

    Total Annual Revenue:

    Less than $1 million

    Total Employees:

    5-10

    Year of Establishment:

    2026

    20 years of production experience in peptide products

    Safe and unobstructed shipping channels|High quality guaranteed|

    Our company is located in Guangzhou, China. Its production facilities are situated in a modern 5,000-square-meter factory. As a private enterprise, we have over 200 professional employees and are actively expanding our team to support future growth. Over the past two decades, as a comprehensive enterprise integrating research, production, processing and export in the chemical industry, we have performed exceptionally well. Since our establishment, we have always adhered to the principles of "honest management, strict quality control, and customer-oriented service", and have received continuous praise from global customers. Our company is a Chinese manufacturer of peptide products, guaranteeing product quality and effectiveness at affordable prices. We offer reliable and secure shipping channels with discreet delivery to ensure safe and timely arrival.


  • Inquiry History
    1 Inquiries
    Country Product Purchase Quantity Date Posted
    Indonesia

    LL-37

    5 MG Jun 23, 2026
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.