Product
Supplier
Encyclopedia
Inquiry
Home > Pharmaceutical Intermediates > Bulk Drug Intermediates > LL-37 for Sale > Laboratory In-vitro Peptide Reaget
Laboratory In-vitro Peptide Reaget buy - large image1
Laboratory In-vitro Peptide Reaget buy - image1
Laboratory In-vitro Peptide Reaget buy - image2
Laboratory In-vitro Peptide Reaget buy - image3
Laboratory In-vitro Peptide Reaget buy - image4
Laboratory In-vitro Peptide Reaget buy - image5
Laboratory In-vitro Peptide Reaget buy - image6

Laboratory In-vitro Peptide Reaget

TDS 1 Inquiries

Unit Price:

$50/UNIT FOB

Get Latest Price
CAS No.:

154947-66-7

Grade:

Pharmaceutical Grade

Content:

99%

Port:

SHENZHEN

Brand:

ADGN

Packaging:

5mg

Price valid (until):

2026-08-15

Company Type:
Trader
Location:
China
Qualification:
Main Products:

Retatrutide,Tirzepatide,Semaglutide,GHK-CU

  • Product Description

  • Seller Information

  • Inquiry History

  • Description
    Items Specifications
    Product Name Synthetic Biochemical Peptide Intermediate
    Model No. PEP-019
    Appearance White to off-white lyophilized powder
    Purity (HPLC) ≥98.0%
    Storage Condition Sealed storage at -20℃, protected from light, avoid repeated freeze-thaw cycles
    Solubility Soluble in purified water
    Shelf Life 24 months under recommended storage condition
    Supporting Documents COA, HPLC Spectrum
    Packaging Sealed glass vial / Aluminum foil bag


    Important Statement

    This product is synthetic biochemical peptide intermediate, only for in-vitro laboratory scientific research, chemical structure analysis, organic synthesis experiments and liquid chromatographic analysis. It is prohibited to be used for human application, in-vivo animal experiments, clinical testing, medical diagnosis and treatment, and any application on living organisms. It cannot be used as raw materials for medicines, food or cosmetics.

    Product Overview

    This product is manufactured by solid-phase peptide synthesis technology, appearing as white to off-white lyophilized powder with good solubility in purified water. Low-temperature vacuum freeze-drying and multi-stage chromatographic purification are adopted during production to strictly control impurities and ensure stable and consistent physicochemical indicators between batches. It is widely applied in basic biochemical research, exploration of peptide synthesis routes, analysis of laboratory reference samples and preliminary screening of innovative pharmaceutical intermediates.

    We maintain stock of various sample sizes and bulk raw materials to serve university research institutes, biological laboratories and pharmaceutical R&D enterprises. Custom specifications, neutral unbranded packaging and private labeling services are available to protect clients’ research data, meeting diverse purchasing demands from preliminary lab trials to long-term research projects.

    Product Advantages

    1. Mature solid-phase synthesis and chromatographic purification system, high-purity lyophilized powder with good batch-to-batch repeatability;
    2. Multiple specifications in continuous stock. Micro samples and bulk materials can be supplied steadily for different research phases;
    3. Complete test documents including COA certificate and HPLC chromatogram are available for each batch to realize full quality traceability;
    4. Neutral confidential packaging and customized labels are supported to prevent leakage of research information;
    5. Adequate inventory and standardized order workflow. Re-inspection, aseptic subpackaging and shipment will be arranged rapidly after order confirmation;
    6. Stable physicochemical properties, suitable for in-vitro biochemical reactions, organic synthesis research and liquid phase purity calibration;
    7. Small trial orders are acceptable to reduce preliminary research costs for scientific teams.

    Quality Control

    We implement standardized full-process inspection for peptide products. Appearance inspection and HPLC purity test will be carried out before delivery. All subpackaging work is completed under clean environment. Hermetic packaging reduces risks of moisture absorption, oxidation and degradation during long-distance international transportation, maintaining sample stability. Electronic test documents can be provided for clients’ filing and internal review.

    Packaging Introduction

    Standard lab sample package: independent sealed glass vial Bulk material package: vacuum sealed aluminum foil bag Outer package: shockproof carton with buffer filling materials Optional service: neutral unbranded confidential packaging, custom label printing All goods will pass secondary tightness inspection before delivery to resist extrusion, high humidity and light exposure during international shipping.

    Storage & Shelf Life

    Store sealed at -20℃ away from light; avoid repeated freeze-thaw cycles. Under recommended storage conditions, shelf life is 24 months.

    Logistics & Lead Time

    Global express and cross-border special logistics lines can be selected according to destination and time requirement. Tracking number will be provided after shipment. Lead Time: Goods will be inspected, packed and shipped within 48–72 hours after order confirmation Shipping Time: Normally 7–15 working days, subject to customs clearance progress and selected logistics method.

    Shop Laboratory In-vitro Peptide Reaget-Detailed Image 1 Shop Laboratory In-vitro Peptide Reaget-Detailed Image 2 Shop Laboratory In-vitro Peptide Reaget-Detailed Image 3 Shop Laboratory In-vitro Peptide Reaget-Detailed Image 4 Shop Laboratory In-vitro Peptide Reaget-Detailed Image 5 Shop Laboratory In-vitro Peptide Reaget-Detailed Image 6 Shop Laboratory In-vitro Peptide Reaget-Detailed Image 7 Shop Laboratory In-vitro Peptide Reaget-Detailed Image 8 Shop Laboratory In-vitro Peptide Reaget-Detailed Image 9 Shop Laboratory In-vitro Peptide Reaget-Detailed Image 10

    Payment and Shipping Methods

    • DHL Global Express

      Door-to-door delivery globally, full cold chain with dry ice, trackable tracking number, smooth customs clearance worldwide.
    • FedEx Global Air Express

      Stable air space, professional customs clearance service, suitable for medium & bulk orders.
    • Local National Postal Lines (Including USPS)

      Cost-effective for 1g-10g small trial samples, final delivery by local post office.
    • Bank T/T Wire Transfer: Formal USD settlement, for bulk orders
    • USDT: USD-pegged stable coin, no exchange loss, widely used in chemical trade
    • Bitcoin BTC: Peer-to-peer on-chain private settlement
    • Shop PT41 Research Grade Synthetic Peptide-Detailed Image 16 Shop PT41 Research Grade Synthetic Peptide-Detailed Image 17 Shop PT41 Research Grade Synthetic Peptide-Detailed Image 18 Shop PT41 Research Grade Synthetic Peptide-Detailed Image 19

    Certificates

    Basic Info
    Product Name:

    LL-37

    Other Name:

    Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

    CAS No.:

    154947-66-7

    Molecular Formula:

    C205H340N60O53

    InChIKeys:

    POIUWJQBRNEFGX-XAMSXPGMSA-N

    Molecular Weight:

    0

    EC Number:

    211-519-9

    Color/Form:

    White to off-white

    Characteristics
    Water Solubility:

    Soluble to 1 mg/ml in water

  • Seller Information
    Business Type:

    Trader

    Main Products:

    Retatrutide,Tirzepatide,Semaglutide,GHK-CU

    Location:

    Plot 1, No. 205 Tongbao Road, Jiangdong Subdistrict, Yiwu City, Jinhua City, Zhejiang Province

    Payment Terms:

    TT against B/L draft before shipment,100% TT in advance

    Year of Establishment:

    2026

  • Inquiry History
    1 Inquiries
    Country Product Purchase Quantity Date Posted
    Indonesia

    LL-37

    5 MG Jun 23, 2026
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.