Product
Supplier
Encyclopedia
Inquiry
Home > Biochemical Engineering > Polypeptide > Corticotrophin-releasing hormone, ovine for Sale > Corticotrophin CAS:83930-34-1 98% white powder / Youngshe
Corticotrophin CAS:83930-34-1 98% white powder / Youngshe buy - large image1
Corticotrophin CAS:83930-34-1 98% white powder / Youngshe buy - image1
Corticotrophin CAS:83930-34-1 98% white powder / Youngshe buy - image2
Corticotrophin CAS:83930-34-1 98% white powder / Youngshe buy - image3
Corticotrophin CAS:83930-34-1 98% white powder / Youngshe buy - image4
Corticotrophin CAS:83930-34-1 98% white powder / Youngshe buy - image5
Corticotrophin CAS:83930-34-1 98% white powder / Youngshe buy - image6

Corticotrophin CAS:83930-34-1 98% white powder / Youngshe

Unit Price:

$20-25/UNIT FOB

Get Latest Price
CAS No.:

83930-34-1

Grade:

Chemical Grade

Content:

98%

Port:

chengdu

Brand:

Youngshe

Packaging:

Plastic bottle

Price valid (until):

2030-12-30

Company Type:
Manufactory
Location:
China
Qualification:
Main Products:

Cosmetic peptides,beauty raw materials,custom peptides,pharmaceutical intermediates

  • Product Description

  • Seller Information

  • Description


      Product Detail  


    Name: Corticotrophin

    Cas No.: 83930-34-1

    Sequence:  YSQEPPISLDLTFHLLREVLEMTKADQLAQQAHSNRKLLDIA-NH2

    Molecular formula: C214H348N60O65S

    Molecular weight: 4833.55

    Quantity in stock : 10 grams

    Purity:  >98.0%

    Packing : According to clients  requirements

    Source :  synthetic

    Shipping: Global Delivery

    Shop Corticotrophin CAS:83930-34-1 98% white powder / Youngshe-Detailed Image 1


      Company Profile 


    Shop Corticotrophin CAS:83930-34-1 98% white powder / Youngshe-Detailed Image 2
    Shop Corticotrophin CAS:83930-34-1 98% white powder / Youngshe-Detailed Image 3


      Our Advantages  


    1. Professionalism of production: With more than 20 years of experience in peptide production, to ensure the stability and reliability of each batch of peptide quality.


    2. Professionalism of product efficacy: We are familiar with more than 300 kinds of cosmetic peptides that are now available worldwide, thorough research.


    3.Professionalism of service: customer satisfaction is our greatest work.


    4. Reliability: We always believe that only good reputation and product quality can make a good company.


    5. Flexibility: We offer a variety of peptides, liquid, freeze-dried powder etc.


    6. Variety of products: We offer more than 200 peptides, including Dipeptide, Tripeptide, Tetrapeptide, Pentapeptide, Hexapeptide, Heptapeptide,Octapeptide,Nonapeptide,Decapeptide,Copper peptide, Oligopeptide and so on.




    Packaging & Shipping  


    Shop Corticotrophin CAS:83930-34-1 98% white powder / Youngshe-Detailed Image 4


      F&Q 


    Q1: How do I make an order?
    A: Please contact with us and we will be happy to  assist you with your order.

    Q2: How to start orders or make payments?
    A: Proforma invoice will be sent first after confirmation of order, enclosed our bank information.We accept T/T (Telegraphic  Transfer), or Paypal.

    Q3: How about delivery lead time?
    A:Delivery lead time: About 3-5 days after payment confirmed. (Chinese holiday not included)

    Q4:Is there a discount?
    A:Different quantity has different discount

    Q5: How do you treat quality complaint?
    A:First of all, our quality control will reduce the quality problem to near zero. If there is a real quality problem caused by us, we will send you free goods for replacement or refund your loss.




    Other hot-selling Ingredients:

    Anti-wrinkle peptide

    Anti-aging peptide

    Skin whitening peptide

    Anti-oxidant peptide

    Hair/Eyelash/Eyebrow peptide

    Anti-eyebags Anti-dark circle peptide

    Anti-inflammatory Anti-sensitive peptide

    Anti-ance Anti-microbial peptide

    Anti-cellulite and slimming peptide

    Breast firming and facial redefining peptide

    ... ...

    Contact

    Aileen Chen

    Email: aileen@youngshechem.com

    WhatsApp/WeChat: +8619150309904


    Basic Info
    Product Name:

    Corticotrophin-releasing hormone, ovine

    CAS No.:

    83930-34-1

    Categories:

    Polypeptide

  • Seller Information
    Business Type:

    Manufactory

    Main Products:

    Cosmetic peptides,beauty raw materials,custom peptides,pharmaceutical intermediates

    Location:

    Unit 12, Building 10, No.77, Tianmu Road, Gaoxin West District, Yi County, Chengdu City, Sichuan Province

    Payment Terms:

    TT against copy of documents

    Average lead Time:

    7

    Total Annual Revenue:

    $1 million-$2.5 million

    Total Employees:

    11-50

    Year of Establishment:

    2015

    Certifications:

    ISO9001

    Chengdu YoungShe Chemical Co., Ltd is a new and dynamic high-tech enterprise that is constantly innovating and specializing in the development of beauty peptides. The company is headquartered in Chengdu Hi-tech Development Zone. Since its establishment in early 2015, the company has launched hundreds of beauty peptide products with different functions, which are widely sold at home and abroad.

    Chengdu Youngshe Chemical Co., Ltd.'s main cosmetic peptide products are dipeptide, tripeptide, tetrapeptide, pentapeptide, hexapeptide, and seven peptides ( heptapeptide, octapptide, nonapeptide, decapeptide, and oligopeptide.


  • Country Product Purchase Quantity Date Posted
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.