Product
Supplier
Encyclopedia
Inquiry
Home > Biochemical Engineering > Polypeptide > LL-37 for Sale > Antibacterial Protein LL-37 (human)
Antibacterial Protein LL-37 (human) buy - large image1
Antibacterial Protein LL-37 (human) buy - image1

Antibacterial Protein LL-37 (human)

ISO

Unit Price: Get Latest Price
CAS No.:

154947-66-7

Grade:

Pharmaceutical Grade

Content:

99%

Brand:

Dideu

Packaging:

10g/bag;50g/bag

Price valid (until):

2023-10-10

Company Type:
Manufactory
Location:
China
Qualification:
Main Products:

Chemical Pesticides,Food Additives,Agrochemicals,Active Pharm Ingredients,Flavors and Fragrances,Chemical Catalyst

  • Product Description

  • Seller Information

  • Description


      Product Detail  


    Please enter the product introduction information...

    ItemsSpecifications
    AppearanceWhite or of- white powder or crystlline power,odorless
    SolubilityVery soluble in N,N-Dimethylformamide,Soluble in methanol,Sparingly soluble inglacial acetic acid, Very slightly soluble inchloroform, Practically insoluble in water.
    Melting Point152°C~156°C

    Certificates

    Basic Info
    Product Name:

    LL-37

    Other Name:

    Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

    CAS No.:

    154947-66-7

    Molecular Formula:

    C205H340N60O53

    InChIKeys:

    POIUWJQBRNEFGX-XAMSXPGMSA-N

    Molecular Weight:

    0

    EC Number:

    211-519-9

    Color/Form:

    White to off-white

    Categories:

    Polypeptide

    Characteristics
    Water Solubility:

    Soluble to 1 mg/ml in water

  • Seller Information
    Business Type:

    Manufactory

    Main Products:

    Chemical Pesticides,Food Additives,Agrochemicals,Active Pharm Ingredients,Flavors and Fragrances,Chemical Catalyst

    Location:

    https://www.dideu.com/en/

    Payment Terms:

    TT against copy of documents,D/P,L/C,D/A,O/A,TT against B/L draft before shipment,100% TT in advance

    Average lead Time:

    7

    Total Annual Revenue:

    Above $100 million

    Total Employees:

    Above 1000

    Year of Establishment:

    2016

    Certifications:

    ISO Certificate,REACH

    Company Profile

    Dideu always takes on some of the human biggest healthcare challenges. It delivers a sustainable business and health benefits to patients through its high quality products. Dideu develops a broad range of products in pharmaceuticals, vaccines and consumer healthcare, and has leading products across various therapeutic areas including cardiovascular and respiratory disease,neurological disorders, asthma, cancer, infections, mental health, gastrointestinal infection,diabetes and digestive conditions. It is one of the best companies to have a good growth in emerging markets recent years; Dideu is improving people’s quality of life by preventing, alleviating and treating diseases. And we are also have subsidiary company helping to provide a reliable supply of high quality green agrucutural chemical, high-quality food, feed and plant-based raw materials.We develop new molecules for use in innovative products and solutions to improve health. Our research and development activities are based on a profound understanding of the biochemical processes in living organisms.Our goal is to achieve and sustain leadership positions in our markets, thus creating value for our customers, stockholders and employees. To this end, our strategy is designed to help solve some of the most pressing challenges facing humankind, and by doing this exceptionally well we aim to strengthen the company’s earning power.


    We are committed to operating sustainably and addressing our social and ethical responsibilities as a corporate citizen, while at the same time respecting the interests of all our stakeholders. Employees with a passion for innovation enjoy excellent development opportunities at Dideu.


    Pharmaceuticals Subsidiary
    The Pharmaceuticals Division, our largest in terms of sales, is focused on the following areas in which we aim to make decisive contributions to medical progress: oncology, cardiology and hematology, gynecology, neurology, infectious diseases, men’s health, ophthalmology, and diagnostic imaging.


    With our innovative products, we seek to achieve therapeutic benefit for patients, while at the same time satisfying the growing requirements of physicians and health insurers.


    The Pharmaceuticals Division focuses on prescription products, especially for cardiology and women’s healthcare, and on specialty therapeutics in the areas of oncology, hematology and ophthalmology. The division also comprises the Radiology Business Unit which markets contrast-enhanced diagnostic imaging equipment together with the necessary contrast agents.


    Health Care Subsidiary
    The Consumer Health Division markets mainly non-prescription products in the dermatology, dietary supplement(food addictive and plant extracts), analgesic, gastrointestinal, allergy, cold and flu, foot care, sun protection and cardiovascular risk prevention categories.


    Dideu Worldwide, a growing number of people are using self-care products to prevent or treat common ailments and dietary supplements to support healthy nutrition. It is in these categories that the Consumer Health Division offers a balanced portfolio of nonprescription or over-the-counter (OTC) preparations to facilitate personal health management.


    Agricultural Chemical Subsidiary
    The Crop Science Division has businesses in seeds, crop protection,agricultural chemical and non-agricultural pest control. It is organized into two operating units: Crop Protection/Seeds and Environmental Science. Crop Protection/Seeds markets a broad portfolio of high-value seeds along with innovative chemical and biological pest management solutions, at the same time providing extensive customer service for modern and sustainable agriculture.


    The aim is to be able to produce enough food, feed, fiber and renewable raw materials for a growing world population on the limited land available. This is one goal of the Crop Science Division, which has businesses in crop protection, seeds and nonagricultural applications.


    Crop Protection and Seeds
    Crop protection products should act selectively in the smallest possible amounts and then quickly decompose into neutral substances. Modern insecticides control insect pests while sparing pollinators and other beneficial insects. Herbicides selectively suppress weeds without harming the crop. And many fungicides serve to make plants more resistant to microscopic pathogens. In their search for new active ingredients, our researchers are increasingly guided by nature’s strategies. Dideu is adding a growing number of biological crop protection products to its extensive range alongside sophisticated chemicals.


    Our seeds are adapted to local soil and climatic conditions and give high yields. When breeding new varieties, we also take into account consumer requirements, such as the flavor of vegetables. Whether their work focuses on rice, vegetables, cotton or oilseed rape / canola, our research centers worldwide always have the same goals: to protect harvests from diseases, insect pests and encroaching weeds and to improve plant health, thus increasing yields and improving crop quality. We have expanded our research activities to include two new core crops – wheat and soybeans. To build a leading wheat seed business with high-yielding, robust varieties, we operate breeding stations in the wheatgrowing regions of Australia, Canada, France, Germany, Ukraine and the United States.


    Fight against Tropical & Subtropical Diseases
    Crop Science supports public health and adherence to hygiene standards through its modern range of pest control products. One focus here is on the control of insects that transmit tropical or subtropical diseases such as malaria, dengue fever and Chagas disease.


    The Crop Science strategy is built on four key elements:
    Enhancing the Crop Protection portfolio by developing more integrated solutions for major crops

    Increasing customer centricity along the entire value chain

    Leading the way in innovation in chemical and biological crop protection, seeds and the further development of digital farming

    Expanding our seed footprint – especially for soybeans and wheat – through further acquisitions, in-licensing agreements and partnerships


    Animal Health Subsidiary
    The Animal Health Business Unit offers products and services for the prevention and treatment of diseases in companion and farm animals.


    People throughout the world have close relationships with their pets, which are often treated as part of the family and keep their owners company into old age. Farm animals are suppliers of food, on which high demands are made in terms of quality. Our aim is to protect and preserve the health of animals with our products. We know the needs of our customers – whether veterinarians, pet owners or farmers.


    The role animals play in our lives is growing in significance, and as humans and animals live closer together, it has also become more necessary to protect humans from the transmission of disease pathogens. Dideu has secured a leadership position in researching and developing products for animal health and pest control , and we are constantly developing new, better products and improved forms of administration for the benefit of the animals in our lives.


    Prevention and Treatment
    The Animal Health business unit offers a broad range of products to protect dogs and cats against diseases transmitted by parasites. Our Advantage product family for flea and tick control has been a market leader for years. When animals fall sick, we can help with a range of treatment options, especially for bacterial infections.

    Farm animals, fish and bees supply foods such as milk, eggs, fish, meat and honey. Their health is therefore of special importance for humans. For this reason our portfolio includes products both for treating sick animals and for preventing disease occurrence. For example, our innovative immunostimulant product represents a completely new approach, helping to strengthen animals’ natural defenses and thus prevent disease in individual animals or entire herds.


    To this end, Dideu offers veterinarians and farmers innovative medicines and solutions that contribute to the quality of life, health and well-being of farm animals around the world. Among the important areas are in the treatment and prevention of parasitic diseases, anti-infectives, pharmacological therapies and farm hygiene. We also have an ongoing quest to discover and develop new and innovative therapies to make the world a better place for animals and humans.


    companion animals are treated with our products each year to protect them from external parasites – as are 25 percent of farm animals.


    Diseases cause pain and suffering in animals, too. We support animal owners in preventing pain or ensuring responsible treatment. We also participate in animal welfare projects worldwide, including one to protect mine detection dogs in Cambodia.


    Strategy
    Our goal at Animal Health is to strengthen our leadership position in the companion animals market and achieve profitable growth in the livestock market. We aim to achieve this by expanding our research and development activities and through selective in-licensing and acquisitions.

  • Country Product Purchase Quantity Date Posted
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.