Product
Supplier
Encyclopedia
Inquiry
Home > Pharmaceutical Intermediates > Bulk Drug Intermediates > LL-37 for Sale > LL-37 Peptide 99% White Powder Raw peptide powder 2mg 5mg 10mg
LL-37 Peptide 99% White Powder Raw peptide powder 2mg 5mg 10mg buy - large image1
LL-37 Peptide 99% White Powder Raw peptide powder 2mg 5mg 10mg buy - image1
LL-37 Peptide 99% White Powder Raw peptide powder 2mg 5mg 10mg buy - image2
LL-37 Peptide 99% White Powder Raw peptide powder 2mg 5mg 10mg buy - image3
LL-37 Peptide 99% White Powder Raw peptide powder 2mg 5mg 10mg buy - image4
LL-37 Peptide 99% White Powder Raw peptide powder 2mg 5mg 10mg buy - image5
LL-37 Peptide 99% White Powder Raw peptide powder 2mg 5mg 10mg buy - image6

LL-37 Peptide 99% White Powder Raw peptide powder 2mg 5mg 10mg

TDS

Unit Price: Get Latest Price
CAS No.:

154947-66-7

Grade:

Pharmaceutical Grade

Content:

99%

Port:

HongKong

Brand:

ZLZ peptide=ZhongTuo chemical

Packaging:

2mg 5mg per vial; 10vials/box

Price valid (until):

2025-07-31

Company Type:
Trader
Location:
China
Qualification:
Main Products:

14B,110-64-5

  • Product Description

  • Seller Information

  • Description


      Product Detail  


    Description:

     Email:H15270446286@outlook.com

    Shop LL-37 Peptide 99% White Powder Raw peptide powder 2mg 5mg 10mg-Detailed Image 1

    Product Specification 

    Items Specifications
    Product Name   LL37
    CAS  154947-66-7
    Appearance White power


    Shop Semaglutide 2mg 5mg Customize Lyophilized Powder Peptides Wholesale GLP-1 Sema-Detailed Image 1


    Quick Guide:

    1. Mass production customize available.

    2. Cap color customize, please ask our sales rep. for more color plans.

    3. Vial size and mg content size customize

    4. Shipping channels secure.

    5. Vaccum seal for all of vials. 

    6. Fresh batch every 6-8 days. 


    Our vials are trusted by numerous customers globally

    We aim to help your business grows


    Why choose us  

    1. All peptides and raws purity >=99% purity

    Many HPLC test reports are available (Janoshik).
    2. 100% Safe delivery
    3. Oversea warehouses and stocks: USA, Canada, Europe and Australia.
    4. Cheapest prices in the market, unbeatable!
    5. Payment options: Credit card, bank transfer, wise, alipay, apple pay, google pay, wechat, bitcoin,usdt,Remitly,Money gram,


    Appearance: Powder

    Purity: >99% (or refer to the Certificate of Analysis)

    Shipping Condition: Shipped under ambient temperature as non-hazardous chemical. This product is stable enough for a few weeks during ordinary shipping and time spent in Customs.

    Storage Condition: Dry, dark and at 0 - 4 C for short term (days to weeks) or -20 C for long term (months to years).

    Solubility: To be determined

    Shelf Life: >2 years if stored properly

    Drug Formulation: To be determined

    Stock Solution Storage: 0 - 4 C for short term (days to weeks), or -20 C for long term (months).

    HS Tariff Code: 2934.99.9001

    Shop Hot sale MTII, Melanotan ll high quality factory direct wholesale white powder 10mg-Detailed Image 2

    Shop Semaglutide 2mg 5mg Customize Lyophilized Powder Peptides Wholesale GLP-1 Sema-Detailed Image 3


    Shop Semaglutide 2mg 5mg Customize Lyophilized Powder Peptides Wholesale GLP-1 Sema-Detailed Image 4

    Shop Semaglutide 2mg 5mg Customize Lyophilized Powder Peptides Wholesale GLP-1 Sema-Detailed Image 5

    Shop Semaglutide 2mg 5mg Customize Lyophilized Powder Peptides Wholesale GLP-1 Sema-Detailed Image 6

    Shop Semaglutide 2mg 5mg Customize Lyophilized Powder Peptides Wholesale GLP-1 Sema-Detailed Image 7

    Shop Semaglutide 2mg 5mg Customize Lyophilized Powder Peptides Wholesale GLP-1 Sema-Detailed Image 8


    Peptide Storage Guidelines: General Tips

    When storing peptides, remember to:

    • Store peptide in a cold, dry, dark place
    • Avoid repeated freezing and thawing of peptide
    • Avoid overexposure to the air
    • Avoid light exposure
    • Avoid storing peptides in solution long term
    • Aliquot peptide according to experimental requirements


    Package Specifications

    Shop Wholesale Price Tirzepatide CAS 2023788-19-2 EU USA Safe Shipping weight loss-Detailed Image 10


    Shipping & Payment


    Shop Wholesale Price Tirzepatide CAS 2023788-19-2 EU USA Safe Shipping weight loss-Detailed Image 11

    Company Profile

    Zhuzhou Lusong Zhongtuo Chemical Technology City is located in HuNan province of China.We specializes in exporting high quality Research chemical, medical intermediate, Pharmaceutical chemicals and so on. Our products are produced on the basis of best technical team, advanced equipment, high qualified management which meet the requirements of security and environmental protection. Quality and service as the highest concept, continuous innovation as the driving force, our products are all over the world.We earned customer trust and created a good reputation during these years. We Supply Free of customs clearance, Double Clearance 100% pass delivery to USA, Canada, Australia,Poland, Italy, Sweden, UK, Czech Republic, Spain, Germany, Netherlands, Mexico, Russia, Ukraine, Kazakhstan.Door to door service.

    With many years of experience, it has fostered an extensive knowledge on the products and market to our company which has built the confidence to our customers with the best.

    Our company offers variety of products which can meet your multifarious demands. We adhere to the management principles of "quality first, customer first and credit-based" since the establishment of the company and always do our best to satisfy potential needs of our customers. Our company is sincerely willing to cooperate with enterprises from all over the world in order to realize a win-win situation since the trend of economic globalization has developed with anirresistible force.


    FAQ 

    Q1: May I get one sample before placing order?

    Re: Yes, Sample are available. For normal products, samples are for free and you just need to bear the freight; For those high value products, you just need to freight and certain product cost. When we both cooperate for some times or when you are our VIP customer, free sample will be offered when you need.

    Q2: Which payment is available for your company?

    Re: Credit card, bank transfer, wise, alipay, apple pay, google pay, wechat, bitcoin,usdt,Remitly,Money gram, etc. You can choose the one which is convenient for you.

    Q3: How and when can I get my goods after payment?

    Re: For small quantity products, they will be delivered to you by international courier(DHL, FedEx, TNT etc.) or by air. Usually it will cost 5-7days that you can get the goods after delivery.For large quantity products, shipping by see is worthwhile.It will cost 15 to 30 days to come to your destination port, which depends on where the port is.

    Q4: Is there any possible to use my appointed label or package?

    Re: Yes. If needed, we'd like to.

    Certificates
    • LL-37 Peptide 99% White Powder Raw peptide powder 2mg 5mg 10mg Certificates 1

    Basic Info
    Product Name:

    LL-37

    Other Name:

    Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

    CAS No.:

    154947-66-7

    Molecular Formula:

    C205H340N60O53

    InChIKeys:

    POIUWJQBRNEFGX-XAMSXPGMSA-N

    Molecular Weight:

    0

    EC Number:

    211-519-9

    Color/Form:

    White to off-white

    Characteristics
    Water Solubility:

    Soluble to 1 mg/ml in water

  • Seller Information
    Business Type:

    Trader

    Main Products:

    14B,110-64-5

    Location:

    No. 998, Taizi Road, Qingyun Street, Lusong District, Zhuzhou City, Hunan Province No. 705C-35, Building 2, Huitong Jingang Lusong Clothing Logistics Distribution Center

    Payment Terms:

    TT against copy of documents,D/P,D/A,O/A,TT against B/L draft before shipment,100% TT in advance

    Average lead Time:

    5

    Total Annual Revenue:

    Less than $1 million

    Total Employees:

    11-50

    Year of Establishment:

    2023

    Certifications:

    WSY,KETETAPAN HALAL,BES,CE

    Company Profile
    1. Excellent sales team, best communication service.
    2. Strict quality control system.
    3. Professional R&D team, providing customized services.
    4. Fast and safe delivery


  • Country Product Purchase Quantity Date Posted
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.