Product
Supplier
Encyclopedia
Inquiry
Home > Active Pharmaceutical Ingredients > Other Chemical Drugs > LL-37 for Sale > Research Chemical Peptide Care CAS 154947-66-7 LL-37
Research Chemical Peptide Care CAS 154947-66-7 LL-37 buy - large image1
Research Chemical Peptide Care CAS 154947-66-7 LL-37 buy - image1
Research Chemical Peptide Care CAS 154947-66-7 LL-37 buy - image2
Research Chemical Peptide Care CAS 154947-66-7 LL-37 buy - image3
Research Chemical Peptide Care CAS 154947-66-7 LL-37 buy - image4
Research Chemical Peptide Care CAS 154947-66-7 LL-37 buy - image5
Research Chemical Peptide Care CAS 154947-66-7 LL-37 buy - image6

Research Chemical Peptide Care CAS 154947-66-7 LL-37

Unit Price: Get Latest Price
CAS No.:

154947-66-7

Grade:

Industrial Grade

Content:

99%

Port:

Shanghai

Brand:

Shanghai Jinbei

Packaging:

10vials/box

Price valid (until):

2025-05-16

Company Type:
Trader
Location:
China
Qualification:
Main Products:

pharmaceutical,Cosmetic,Pregabalin,2,5-Dimethoxybenzaldehyde,Diphenylacetonitrile,2-Dimethylaminoisopropyl chloride hydrochloride,Tildenafil

  • Product Description

  • Seller Information

  • Description
    Model Number CAS 154947-66-7
    Brand Name Shanghai Jinbei
    Origin China
    Small Orders Accepted

    Picture

    Shop High Quality Research Chemical Peptide CAS 70-18-8 Glutathione-Detailed Image 1

    Applications:

    LL37 (Human cathelicidin, Ropocamptide) is an antimicrobial peptide related to cathelicidin, with potent chemotactic and immunomodulatory properties.

    Benefits :

    We believe that LL-37 offers an unbeatable combination of quality, performance, and value. If you have any questions about this product or would like to learn more about how it can benefit your business, please don't hesitate to contact us. We are dedicated to providing excellent customer service and helping our customers achieve their business goals.

    Thank you for considering it. We look forward to the opportunity to work with you and help you achieve success.

    Factory Pictures :

    Shop Wholesale Price Chemicals White Powder CAS 1305-62-0 Calcium hydroxide-Detailed Image 2

    Product Pictures: 

    Shop Wholesale Price Chemicals White Powder CAS 1305-62-0 Calcium hydroxide-Detailed Image 3 Shop Wholesale Price Chemicals White Powder CAS 1305-62-0 Calcium hydroxide-Detailed Image 4

    Why choose us :

    At our company, we are dedicated to providing high-quality products and excellent customer service to our B2B customers. Here are some of the reasons why customers choose us:

    1. Own your own chemical plant

    2. Rich professional production experience

    3. Sample free and in stock, delivery

    4. Price, quality and service, we care about all your concerns

    5. Timely reply Keep in touch to save your time

    6. Easy customs clearance, we have all these controlsAll very good

    7. Dedicated researchers customize it for you.

     Shop Wholesale Price Chemicals White Powder CAS 1305-62-0 Calcium hydroxide-Detailed Image 5

    Recommend Products :

    Other related hot products that may be of interest to you.

    List other products from the related categories.

    CAS 138890-62-7

    CAS 144060-53-7

    CAS 231277-92-2

    Product Packaging:Package Type: Color Box + Carton

    Shop Wholesale Price Chemicals White Powder CAS 1305-62-0 Calcium hydroxide-Detailed Image 6

    FAQ:

    1.Q: What is the expected lifespan or durability of the product?

    A: Our product has an expected lifespan of 3 years and is designed to withstand heavy use in industrial environments.


    2. Q: What is your company's experience and reputation in the industry?

    A: Our company has been in business for 2 years and has a reputation for delivering high-quality products and excellent customer service. We have worked with numerous clients in various industries.


    3. Q: Are there any certifications or standards that the product meets?

    A: Yes, our product meets several industry certifications and standard

    Basic Info
    Product Name:

    LL-37

    Other Name:

    Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

    CAS No.:

    154947-66-7

    Molecular Formula:

    C205H340N60O53

    InChIKeys:

    POIUWJQBRNEFGX-XAMSXPGMSA-N

    Molecular Weight:

    0

    EC Number:

    211-519-9

    Color/Form:

    White to off-white

    Categories:

    Other Chemical Drugs

    Characteristics
    Water Solubility:

    Soluble to 1 mg/ml in water

  • Seller Information
    Business Type:

    Trader

    Main Products:

    pharmaceutical,Cosmetic,Pregabalin,2,5-Dimethoxybenzaldehyde,Diphenylacetonitrile,2-Dimethylaminoisopropyl chloride hydrochloride,Tildenafil

    Location:

    shanghai fengqianqu

    Payment Terms:

    TT against copy of documents,D/P,L/C,D/A,O/A,TT against B/L draft before shipment,100% TT in advance

    Average lead Time:

    10

    Total Annual Revenue:

    $10 million-$25 million

    Total Employees:

    11-50

    Year of Establishment:

    2022

    Company Profile 
    Exporting to North America, Europe, Australia, the Middle East
    Shanghai Jinbei Chemical Technology Co., LTD. is a leading cosmetics raw material manufacturer located in Shanghai, China. We mainly produce ketones, alcohols, organic acids, and other fine chemicals and organic chemical raw materials. Our products are exported to North America, Europe, Australia, the Middle East and other regions. At the same time, we can also provide customers with product customization services.

    ISO 9001, ISO 14001 and ISO 45001 Certifications
    We are specialied in the production of pharmaceutical intermediates, veterinary intermediates, dye intermediates with the certifications of ISO 9001, ISO 14001 and ISO 45001. Quanjinci also has its own factory and laboratory to ensure quality. Our factory covers an area of approximately 3,800 square meters. The first-class R&D team, professional production team, and strict quality inspection department make us a leader in the domestic chemical industry.

    Contact Us Now
    After many years of development, Shanghai Jinbei Chemical Technology Co., LTD. has now developed into a diversified company with a business scope covering the chemical industry, real estate, clothing, agricultural products, and other fields. Choose us. You will have a reliable partner, high-quality products, fast and safe transportation, and worry-free after-sales experience. Sincerely hope that we can establish long-term cooperative relations with more customers and achieve a win-win situation.
  • Country Product Purchase Quantity Date Posted
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.