Product
Supplier
Encyclopedia
Inquiry
Home > Biochemical Engineering > Polypeptide > LL-37 for Sale > LL-37 freeze-dried powder LL-37 Strong Peptides Minimum order quantity In stock High purity
LL-37 freeze-dried powder LL-37 Strong Peptides Minimum order quantity In stock  High purity buy - large image1
LL-37 freeze-dried powder LL-37 Strong Peptides Minimum order quantity In stock  High purity buy - image1
LL-37 freeze-dried powder LL-37 Strong Peptides Minimum order quantity In stock  High purity buy - image2
LL-37 freeze-dried powder LL-37 Strong Peptides Minimum order quantity In stock  High purity buy - image3
LL-37 freeze-dried powder LL-37 Strong Peptides Minimum order quantity In stock  High purity buy - image4
LL-37 freeze-dried powder LL-37 Strong Peptides Minimum order quantity In stock  High purity buy - image5
LL-37 freeze-dried powder LL-37 Strong Peptides Minimum order quantity In stock  High purity buy - image6

LL-37 freeze-dried powder LL-37 Strong Peptides Minimum order quantity In stock High purity

Unit Price: Get Latest Price
CAS No.:

154947-66-7

Grade:

Pharmaceutical Grade

Content:

99%

Port:

Shanghai

Brand:

Jinbei

Packaging:

5mg 10mg 20mg Vials, 10vials/box

Price valid (until):

2025-09-14

Company Type:
Trader
Location:
China
Qualification:
Main Products:

pharmaceutical,Cosmetic,Pregabalin,2,5-Dimethoxybenzaldehyde,Diphenylacetonitrile,2-Dimethylaminoisopropyl chloride hydrochloride,Tildenafil

  • Product Description

  • Seller Information

  • Description


      Description  


    Sales Manager : Cathy

    Whatsapp/Tel/WeChat:+86 190 3139 6783

    Email:cathy@jinbeichem.cn

    We are specialized in exporting various chemical products, chemical raw materials, the full range of peptide products, cosmetic raw materials, etc. If you have any needs, please feel free to contact me!



      Product Detail  



    Items Specifications
    CAS 154947-66-7
    Molecular formula C205H340N60O53
    Molecular weight 0


    Product Name Model Number Dimensions
    Research Peptide 5mg 10mg 20mg Vials 10 vials/kit
    Peptide 5mg 10mg 20mg Vials 10 vials/kit


    Shop Quality products CAS 67727-97-3 α-MSH (11-13) (free acid) α-Melanotropin(11-13) H-LYS-PRO-VAL-OH ACETATE SALT Factory price-Detailed Image 1

    Shop Quality products CAS 67727-97-3 α-MSH (11-13) (free acid) α-Melanotropin(11-13) H-LYS-PRO-VAL-OH ACETATE SALT Factory price-Detailed Image 2

    Shop Quality products CAS 67727-97-3 α-MSH (11-13) (free acid) α-Melanotropin(11-13) H-LYS-PRO-VAL-OH ACETATE SALT Factory price-Detailed Image 3



    Specification 99%
    Packing 5mg/vial;10mg/vial;20mg/vial(10vials/box)
    Shelf 2 Years


    Benefits:


    1. Ultra-low temperature freezing: Freeze the highly active ingredients at -196 degrees to put the active ingredients into a dormant state.

    2. Effective regeneration: Add the solvent to the powder when using it, and it can be effectively regenerated after mixing, ensuring the high activity and high stability of the product.


    We offer various types of peptides, and we can provide excellent quality and preferential prices for peptides.

    The feedback from customers who have ordered our products (peptides) is very good.

    Reliable buyers around the world can contact us for peptide matters.


    We believe that Jinbei offers an unparalleled combination of quality, performance and value. If you have any questions about this product or want to learn more about how it can benefit your business, please feel free to contact us. We are committed to providing excellent customer service and helping our customers achieve their business goals.Thank you for considering Jinbei. We look forward to the opportunity to work with you and help you succeed.

    Shop Quality products CAS 67727-97-3 α-MSH (11-13) (free acid) α-Melanotropin(11-13) H-LYS-PRO-VAL-OH ACETATE SALT Factory price-Detailed Image 4

    Shop Professional Supplier Copper Peptide CAS 49557-75-7 GHK Cu Copper Peptide Quality assurance-Detailed Image 5

    Shop Professional Supplier Copper Peptide CAS 49557-75-7 GHK Cu Copper Peptide Quality assurance-Detailed Image 6


      Company Profile


    Shanghai JinBei Chemical Technology Co., LTD is a leading cosmetics raw material manufacturer located in Shanghai of China. We mainly produce ketones, alcohols, organic acids, caine and other fine chemicals and organic chemical raw materials. Products are exported to North America, Europe, Australia, Middle East and other regions. At the same time, we can also provide customers with product customization services. We are specialied in the production of pharmaceutical intermediates, veterinary intermediates, dye intermediates with certification of ISO9001, ISO14001 and ISO45001.Quanjinci also has its own factory and laboratory to insure the quality.Our factory covers an area of approximately 3,800 square meters. The first-class R&D team, professional production team, and strict quality inspection department make us a leader in the domestic chemical industry. After many years of development, JINBEI Now it has developed into a diversified company with business scope covering chemical industry, real estate, clothing, agricultural products and other fields. Future, JINBEI must become a more important trade bridge between China and foreign countries, especially in the pharmaceutical industry. Choosing us, you will have a reliable partner, high-quality products, fast and safe transportation, and worry-free after-sales experience. Sincerely hope that we can establish long-term cooperative relations with our customers and achieve a win-win situation.

    Shop Wholesale price CAS 4584-49-0 2-Dimethylaminoisopropyl chloride hydrochloride N-(2-Chloropropyl)dimethylamine After-sales service-Detailed Image 3

    Shop Wholesale price CAS 4584-49-0 chloride hydrochloride N-(2-Chloropropyl) After-sales service-Detailed Image 6

    Shop Wholesale price CAS 4584-49-0 chloride hydrochloride N-(2-Chloropropyl) After-sales service-Detailed Image 7


      Packaging and transportation  


    Shop Wholesale price CAS 4584-49-0 2-Dimethylaminoisopropyl chloride hydrochloride N-(2-Chloropropyl)dimethylamine After-sales service-Detailed Image 4

    Shipping

    By courier
    Suitable for less than 50kg, fast: 3-4 days. High cost; door-to-door delivery. Convenient to pick up.
    FedEx, DHL, EMS, UPS
    By plane
    Suitable for more than 50kg, fast: 4-5 days. High cost: need professional broker from airport to airport
    Sea transport
    Suitable for more than 500kg, slow: 15-45 days low cost. Port to port, you need professional broker.
    Shop Wholesale price CAS 4584-49-0 2-Dimethylaminoisopropyl chloride hydrochloride N-(2-Chloropropyl)dimethylamine After-sales service-Detailed Image 5

    Products Description


    China supplier peptides powder peptides vials 5mg 10mg various peptides


    Peptide Form: Lyophilized Powder

    Peptide Package: 10 Vials per box

    Peptide Purity: 99%

    Peptide MOQ: 1 kit (10 vials)


    We offer various types of peptides,a bout the peptides,we can provide the good quality,the good price.

    Customers who have ordered our products(peptides)have had very good feedback.

    World wide relaible buyers can contact us about the peptides.

    Product Name 99.9% peptide
    Appearance Powder
    Usage Cosmetic Raw Materials
    Package 5mg/vial,10mg/vial,20mg/vial,(10vials/box)
    Storage cool and dry place

    Features:


    Peptide China Supply Research Peptides Powder 5mg 10mg 20mg peptides vials


    If you have any questions about this product or would like to learn more about how it can benefit your business, please don't hesitate to contact us. We are dedicated to providing excellent customer service and helping our customers achieve their business goals.

    We look forward to the opportunity to work with you and help you achieve success.

    Shop Quality products CAS 67727-97-3 α-MSH (11-13) (free acid) α-Melanotropin(11-13) H-LYS-PRO-VAL-OH ACETATE SALT Factory price-Detailed Image 12

    Shop Professional Supplier Copper Peptide CAS 49557-75-7 GHK Cu Copper Peptide Quality assurance-Detailed Image 13

    Shop Wholesale price CAS 4584-49-0 2-Dimethylaminoisopropyl chloride hydrochloride N-(2-Chloropropyl)dimethylamine After-sales service-Detailed Image 6
    Shop Wholesale price CAS 4584-49-0 2-Dimethylaminoisopropyl chloride hydrochloride N-(2-Chloropropyl)dimethylamine After-sales service-Detailed Image 7
    Shop Wholesale price CAS 4584-49-0 2-Dimethylaminoisopropyl chloride hydrochloride N-(2-Chloropropyl)dimethylamine After-sales service-Detailed Image 8
    Shop Wholesale price CAS 4584-49-0 2-Dimethylaminoisopropyl chloride hydrochloride N-(2-Chloropropyl)dimethylamine After-sales service-Detailed Image 9




    Similar product recommendations:


    CAS 86-29-3

    CAS 93-02-7

    CAS 4584-49-0

    CAS 86386-73-4

    CAS 85-79-0

    CAS 59-58-5

    CAS 545445-44-1

    CAS 1119-51-3


    Shop LL-37 154947-66-7 freeze-dried powder Made in China Hot selling  High purity-Detailed Image 18


      Our advantages


    1. We have our own chemical plant.

    2. We have long-term cooperation with Europe, North America, South America, the Middle East and Asia for export. We have rich professional production experience.

    3. Timely reply to keep in touch and save your time.

    4. Convenient customs clearance, we have these control measures, everything is fine.

    5. Dedicated researchers tailored for you. We can customize and develop a variety of corresponding products according to the special requirements of customers, and provide customers with strong technical support and a whole set of industry solutions.

    6. Price, quality and service, we care about all your concerns. We provide the best private label Jinbei service to meet different customers. Welcome to contact us!

    Shop Wholesale price CAS 4584-49-0 2-Dimethylaminoisopropyl chloride hydrochloride N-(2-Chloropropyl)dimethylamine After-sales service-Detailed Image 11


    FAQ


    Why choose us?

    Professional, Rich Experience.

    1)Rich experience for Europe&North America&South America&Middle East&Asiaexport.

    2)Full experience of large numbers containers loading in Chinese sea port.


    Our Advantages.

    1)All purity>99%.

    2)High quality with competitive price.

    3)We are manufacturer and can provide high quality products with factory price.


    Fast and safe delivery.

    1)Parcel can be sent out in 24 hours after payment tracking number available.

    2)Secure and discreet shipment verious transportation methods for your choice.

    3)Customs pass rate >99%. 


    We have clients throughout the world.

    1)Professional service and rich experience make customers feel at ease, adequate stock and fast delivery meet their different desire.

    2)Market feedback and goods feedback will be appreciated, meeting customers' requirement is our principal responsibility.

    3)High quality, competitive price, fast delivery, first-class service gain the trust and praise from all the customers.


    How to proceed your order:

    Step 1:Please let me know the items you are favorable, quantities, and the destination country.

    Step 2:You confirm all detail, and offer purchasing order.

    Step 3:We send the detail price of our product and offer the suitable shipping method for reference.

    Step 4:You confirm the order and payment 100% in advance and send us the detailed contacting information, including contacting person/company,address,mobile number,ZIP code and your special requirements.

    Step5:We arrange the shipment according to your requirements, and tracking code will be offered once it is released, then you can track your parcel at any moment.

    Step 6:We offer after-sales services after service after you receive your parcel

    Basic Info
    Product Name:

    LL-37

    Other Name:

    Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

    CAS No.:

    154947-66-7

    Molecular Formula:

    C205H340N60O53

    InChIKeys:

    POIUWJQBRNEFGX-XAMSXPGMSA-N

    Molecular Weight:

    0

    EC Number:

    211-519-9

    Color/Form:

    White to off-white

    Categories:

    Polypeptide

    Characteristics
    Water Solubility:

    Soluble to 1 mg/ml in water

  • Seller Information
    Business Type:

    Trader

    Main Products:

    pharmaceutical,Cosmetic,Pregabalin,2,5-Dimethoxybenzaldehyde,Diphenylacetonitrile,2-Dimethylaminoisopropyl chloride hydrochloride,Tildenafil

    Location:

    shanghai fengqianqu

    Payment Terms:

    TT against copy of documents,D/P,L/C,D/A,O/A,TT against B/L draft before shipment,100% TT in advance

    Average lead Time:

    10

    Total Annual Revenue:

    $10 million-$25 million

    Total Employees:

    11-50

    Year of Establishment:

    2022

    Company Profile 
    Exporting to North America, Europe, Australia, the Middle East
    Shanghai Jinbei Chemical Technology Co., LTD. is a leading cosmetics raw material manufacturer located in Shanghai, China. We mainly produce ketones, alcohols, organic acids, and other fine chemicals and organic chemical raw materials. Our products are exported to North America, Europe, Australia, the Middle East and other regions. At the same time, we can also provide customers with product customization services.

    ISO 9001, ISO 14001 and ISO 45001 Certifications
    We are specialied in the production of pharmaceutical intermediates, veterinary intermediates, dye intermediates with the certifications of ISO 9001, ISO 14001 and ISO 45001. Quanjinci also has its own factory and laboratory to ensure quality. Our factory covers an area of approximately 3,800 square meters. The first-class R&D team, professional production team, and strict quality inspection department make us a leader in the domestic chemical industry.

    Contact Us Now
    After many years of development, Shanghai Jinbei Chemical Technology Co., LTD. has now developed into a diversified company with a business scope covering the chemical industry, real estate, clothing, agricultural products, and other fields. Choose us. You will have a reliable partner, high-quality products, fast and safe transportation, and worry-free after-sales experience. Sincerely hope that we can establish long-term cooperative relations with more customers and achieve a win-win situation.
  • Country Product Purchase Quantity Date Posted
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.