Product
Supplier
Encyclopedia
Inquiry
Home > Biochemical Engineering > Polypeptide > LL-37 for Sale > LL37 99% Purity Powder High Quality good price
LL37  99% Purity  Powder High Quality  good price buy - large image1
LL37  99% Purity  Powder High Quality  good price buy - image1
LL37  99% Purity  Powder High Quality  good price buy - image2
LL37  99% Purity  Powder High Quality  good price buy - image3
LL37  99% Purity  Powder High Quality  good price buy - image4
LL37  99% Purity  Powder High Quality  good price buy - image5
LL37  99% Purity  Powder High Quality  good price buy - image6

LL37 99% Purity Powder High Quality good price

TDS

Unit Price:

$20-25/G FOB

Get Latest Price
CAS No.:

154947-66-7

Grade:

Pharmaceutical Grade

Content:

99%

Port:

GUANGZHOU

Brand:

APKX

Packaging:

5 mg/vial

Price valid (until):

2026-07-22

Company Type:
Trader
Location:
China
Qualification:
Main Products:

peptides

  • Product Description

  • Seller Information

  • Description


      Product Detail


    Appearance: Powder

    Our products enjoy good reputation both at home and abroad. Our trade partners are around the world, mainly in America,Europe,Australia,South East Asia ,Middle East and South Africa. In order to serve customers well, the company has established special technical department and after-sale service department. We will make careful reply if you get any question.

    The company with all the employees will constantly purse excellent quality, perfect brand and our image, and adheres to our spirit of honesty, diligence, seeking truth and progress and insists on business philosophy of quality as life and service as soul. We will satisfy market demands by top products and better service, and will welcome market challenge forever.

    Appearance: Powder


    • Shop LL37  99% Purity  Powder High Quality  good price-Detailed Image 1 Shop LL37  99% Purity  Powder High Quality  good price-Detailed Image 2
    • Shop LL37  99% Purity  Powder High Quality  good price-Detailed Image 3
    • Shop LL37  99% Purity  Powder High Quality  good price-Detailed Image 4






    Items Specifications
    Purity >99%
    Appearance  Powder
    MOQ 10vials

    Shop LL37  99% Purity  Powder High Quality  good price-Detailed Image 5



    Function  of peptides

     

    Many active substances in the human body are in the form of peptides.

    Peptides are important substances involved in various cell functions in human body. Peptides can be synthesized into cells and regulate their functional activities. Peptides act as neurotransmitters in the body, transmitting information. Peptides can be used as transportation tools in the human body to transport various nutrients and various vitamins, biotin, calcium and trace elements beneficial to the human body to the cells, organs and tissues of the human body. Peptide is an important physiological regulator of the human body, which can comprehensively regulate the physiological function of the human body, enhance and exert the physiological activity of the human body, and it has important biological functions.

    Shop LL37  99% Purity  Powder High Quality  good price-Detailed Image 6

    Shop LL37  99% Purity  Powder High Quality  good price-Detailed Image 7

      Why Choose us  

     


    Quality Above 99% Purity, manufacturer direct supply the products

    Tranport : Over 99% customs clearance can be guaranteed, the delivery time within 48h and arrival time is 1-2 weeks, Even if the goods are detained, i will resend the goods.

    Price : We do not engagein price wars. Our first quotation may too expensive to you, please don't lose heart. Firstly, our quality can be guaranteed; Secondly, our tranportation efficiency and custome clearance rate can be guaranteed; Thirdly, we will provide you with the highest quality service, in any aspect.

    You get what you pay off, if you have any questions, i will have the answer.

    Shop LL37  99% Purity  Powder High Quality  good price-Detailed Image 8

    Shop LL37  99% Purity  Powder High Quality  good price-Detailed Image 9


    Product Storage Guidelines  

     


    When storing peptides, remember to:
    • Store peptide in a cold, dry, dark place
    • Avoid repeated freezing and thawing of peptide
    • Avoid overexposure to the air
    • Avoid light exposure
    • Avoid storing peptides in solution long term
    • Aliquot peptide according to experimental requirements

    Shop LL37  99% Purity  Powder High Quality  good price-Detailed Image 10

    Shop LL37  99% Purity  Powder High Quality  good price-Detailed Image 11

      With our constant efforts and good service, We sincerely hope to establish long-term cooperation and common development with our customers .

    Shop LL37  99% Purity  Powder High Quality  good price-Detailed Image 12

    • FAQ

       


      Q: Are you trading company or manufacturer?

      A: We are chemical manufacturerin China. Can provide the top quality and wholesale price.


      Q: Has the quality of your products passed the test of a third-party authoritative testing agency?

      A: Yes, all products are strictly tested by our quality control before shipment, and the quality assurance is confirmed and

      approved by third-party laboratories.  


      Q: How to confirm the Product Quality before placing orders?

      A: You can buy samples for some products,and there will be discount for sample, after testing our sample, if all is ok for you, when make bulk order, we can return the sample fee back to you, and you can also send us your requirement for some special item, we can found for you in our local market.


      Q: How to start orders or make payments?

      A: You can send your requirement here on line,or send your purchase order by email to us, and we will send you Proforma Invoice with our bank details for your confirmation, then you can make payment accordingly.


      Q: What's your MOQ?

      A: For this product,,10mg,50mg/vials, 1box is 10vials, minimum order is 1 boxes.


      Q: Is there a discount

      A: Different quantity has different discount, for larger quantity, we alway support with better price.


      Q7: How about the delivery time?

      A7: The delivery time is about 7-15 days after confirming the payment. Delivery times vary from country to country. (excluding

      Chinese holidays)

    For payment: We can accept Bitcoin,Paypal, bank TT to company, bank TT to private account

    Certificates
    • LL37  99% Purity  Powder High Quality  good price Certificates 1

    Basic Info
    Product Name:

    LL-37

    Other Name:

    Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

    CAS No.:

    154947-66-7

    Molecular Formula:

    C205H340N60O53

    InChIKeys:

    POIUWJQBRNEFGX-XAMSXPGMSA-N

    Molecular Weight:

    0

    EC Number:

    211-519-9

    Color/Form:

    White to off-white

    Categories:

    Polypeptide

    Characteristics
    Water Solubility:

    Soluble to 1 mg/ml in water

  • Seller Information
    Business Type:

    Trader

    Main Products:

    peptides

    Location:

    Room 3043, 3rd Floor, Building 15, No. 185 Xinda Road, Wanghailou Street, Hebei District, Tianjin

    Payment Terms:

    TT against copy of documents,D/P,L/C,D/A,O/A,TT against B/L draft before shipment,100% TT in advance

    Average lead Time:

    7

    Total Annual Revenue:

    $10 million-$25 million

    Total Employees:

    11-50

    Year of Establishment:

    2025

    Certifications:

    .,证书


       公司简介  


    Company Profile
    We are a modern, rapidly growing biopharmaceutical company specializing in the production of pharmaceuticals, biologics, and nutraceuticals. We offer internationally leading healthcare products, chemicals, electronics, and mining machinery. Our innovative, full-cycle production facilities fully comply with GMP and ISO standards. We are committed to providing high-quality, affordable, innovative products to prevent disease and support healthier lifestyles. We optimize scientific innovation and production technologies to enable our customers to better serve their consumers. We provide a comprehensive range of services and products for the pharmaceutical and nutraceutical industries, from custom development and production of active ingredients to finished dosage forms. With our scale and resources, we offer our customers one-stop solutions to help people get, feel, and stay well.
    
  • Country Product Purchase Quantity Date Posted
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.