Product
Supplier
Encyclopedia
Inquiry
Home > Active Pharmaceutical Ingredients > Other Chemical Drugs > LL-37 for Sale > 99% Lyophilized Powder LL37 Copper Peptide Powder High Quality Factory Direct Sales
99% Lyophilized Powder LL37 Copper Peptide Powder High Quality Factory Direct Sales buy - large image1
99% Lyophilized Powder LL37 Copper Peptide Powder High Quality Factory Direct Sales buy - image1
99% Lyophilized Powder LL37 Copper Peptide Powder High Quality Factory Direct Sales buy - image2
99% Lyophilized Powder LL37 Copper Peptide Powder High Quality Factory Direct Sales buy - image3
99% Lyophilized Powder LL37 Copper Peptide Powder High Quality Factory Direct Sales buy - image4
99% Lyophilized Powder LL37 Copper Peptide Powder High Quality Factory Direct Sales buy - image5
99% Lyophilized Powder LL37 Copper Peptide Powder High Quality Factory Direct Sales buy - image6

99% Lyophilized Powder LL37 Copper Peptide Powder High Quality Factory Direct Sales

TDS

Unit Price: Get Latest Price
CAS No.:

154947-66-7

Grade:

Pharmaceutical Grade

Content:

99%

Port:

shanghai

Brand:

DX

Packaging:

10mg/vial,40vials/box

Price valid (until):

2026-03-20

Company Type:
Trader
Location:
China
Qualification:
Main Products:

GLP-1,trizepatide,Semaglutide,Retatrutide

  • Product Description

  • Seller Information

  • Description



    Name:Nancy

    whatsapp+86  19831965506

    Email Address:nancy@xtdaxiang.cn


      Product Detail  


    What is LL37  

    LL37 (also known as CAP18 derivative peptide) is a cationic antimicrobial peptide synthesized by the human body. It is a key defense molecule of the human innate immune system. It possesses multiple biological activities such as broad-spectrum antibacterial, anti-inflammatory, and immune regulation properties. Moreover, it is derived from the human body, has high biocompatibility and low risk of drug resistance. It has broad application prospects in the fields of medicine, cosmetics, and animal husbandry.



    Shop 99% Lyophilized Powder LL37 Copper Peptide Powder High Quality Factory Direct Sales-Detailed Image 1
    Shop 99% Lyophilized Powder LL37 Copper Peptide Powder High Quality Factory Direct Sales-Detailed Image 2 Shop 99% Lyophilized Powder LL37 Copper Peptide Powder High Quality Factory Direct Sales-Detailed Image 3

    Items Specifications
    Product name LL37
    Appearance white powder
    Package 10 vials/box
    Storage method cool dry place
    purity More than 99%
    shelf life 2 years


        

    Core product advantages:

    1. Human-derived, with extremely high biocompatibility: Derived from human peptides, it has no immunogenicity and is unlikely to cause allergic reactions. It can directly act on sensitive areas such as human mucous membranes and skin.

    2. Multi-functionality, wide application scope: It combines antibacterial, anti-inflammatory, repair, and immune regulation functions. It can achieve "defense + repair" dual effects without the need to combine multiple components.

    3. High purity, easy to prepare: Artificial synthesis can reach a 99% high purity level. The product is in the form of white freeze-dried powder, has good water solubility, and can be used in combination with other peptides and active ingredients.

    4. Safe and residue-free: Different from chemical antibiotics, it can be degraded into amino acids by proteases in the human body and does not cause damage to normal human cells.

    .Shop 99% Lyophilized Powder LL37 Copper Peptide Powder High Quality Factory Direct Sales-Detailed Image 4

    Shop 99% Lyophilized Powder LL37 Copper Peptide Powder High Quality Factory Direct Sales-Detailed Image 5

     Product Application   

    1. 1. Medical and health field

      Antimicrobial drugs: Used for treating skin infections, mucosal infections, chronic wounds, especially as an alternative treatment for resistant bacterial infections.

      Topical preparations: Formed into ointments, gels, mouthwashes, nasal sprays, etc., directly acting on the infected or inflamed areas, with rapid efficacy.

      Medical material modification: Added to medical dressings, catheters, artificial skin and other material surfaces, giving antibacterial functions and reducing the risk of postoperative infections.

      2. Cosmetics and skincare field

      Functional skin care products: Added to acne-removing products, sensitive skin repair products (anti-inflammatory, repairing the skin barrier), wound care products (accelerating the healing of small wounds), anti-aging products (promoting skin metabolism, improving inflammatory aging).

      Advantages: Gentle and non-irritating, replacing traditional preservatives, antibiotic-type acne-removing ingredients, suitable for long-term use, especially suitable for sensitive skin and acne-prone individuals.


    2. Shop 99% Lyophilized Powder LL37 Copper Peptide Powder High Quality Factory Direct Sales-Detailed Image 6


                                                                      Shipping  


    Shop 99% Lyophilized Powder LL37 Copper Peptide Powder High Quality Factory Direct Sales-Detailed Image 7

    Shop High Purity QSC Retatrutide GLP-1 GIP GCG Peptide 10mg 20mg 30mg 60mg Fast Delivery-Detailed Image 7



    Why choose us?

    Our Advantages:
    1.High quality with competitive price.
    2.All purity>99%.
    3. We are manufacturer and can provide high quality products with factory price.

    Fast and safe delivery:
    1. Parcel can be sent out in 48 hours after payment tracking number available.
    2. Secure and discreet shipment verious transportation methods for your choice.
    3. Customs pass rate >99%.


    Company Profile

      Daxiang Technology Co., Ltd., is a high-tech enterprise focusing on the research, development and production of peptide products. The company was established in recent years and is committed to applying advanced biotechnology to the health industry to meet the market's demand for high-quality, high-efficiency peptide products.​

      As a leading peptide manufacturer, Daxiang Technology has a R&D team composed of senior scientists and engineers, which continues to explore and innovate, and is committed to developing safer, more effective, and more market-competitive peptide products. The company's main products cover but are not limited to pharmaceutical grade, food grade and cosmetic grade and other fields, and are widely used in many aspects such as health care, disease prevention, beauty and skin care.​

      In terms of production technology, Daxiang Technology adopts internationally advanced production equipment and technology to ensure that every aspect of the product, from raw material selection, production and processing to finished product packaging, strictly follows relevant national standards and specifications to ensure product quality and safety. At the same time, the company has also established a complete quality management system and after-sales service system to provide customers with all-round, one-stop service support.​

      Daxiang Technology adheres to the corporate philosophy of "technology leads health, quality creates the future" and always adheres to the development path of people-oriented and technological innovation. The company not only focuses on product quality and innovation, but also actively fulfills its social responsibilities and is committed to promoting the development and progress of the health industry.​

      In the future,Daxiang Technology Co., Ltd. will continue to delve into the field of peptide product research and development, continue to explore and make breakthroughs, and strive to become a leader in the global peptide industry and make greater contributions to human health.


    Shop High Purity QSC Retatrutide GLP-1 GIP GCG Peptide 10mg 20mg 30mg 60mg Fast Delivery-Detailed Image 9



    Shop High Purity QSC Retatrutide GLP-1 GIP GCG Peptide 10mg 20mg 30mg 60mg Fast Delivery-Detailed Image 10



    Shop High Purity QSC Retatrutide GLP-1 GIP GCG Peptide 10mg 20mg 30mg 60mg Fast Delivery-Detailed Image 11



    Shop High Purity QSC Retatrutide GLP-1 GIP GCG Peptide 10mg 20mg 30mg 60mg Fast Delivery-Detailed Image 12

    Shop High Purity QSC Retatrutide GLP-1 GIP GCG Peptide 10mg 20mg 30mg 60mg Fast Delivery-Detailed Image 13


    Certificates
    • 99% Lyophilized Powder LL37 Copper Peptide Powder High Quality Factory Direct Sales Certificates 1

    Basic Info
    Product Name:

    LL-37

    Other Name:

    Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

    CAS No.:

    154947-66-7

    Molecular Formula:

    C205H340N60O53

    InChIKeys:

    POIUWJQBRNEFGX-XAMSXPGMSA-N

    Molecular Weight:

    0

    EC Number:

    211-519-9

    Color/Form:

    White to off-white

    Categories:

    Other Chemical Drugs

    Characteristics
    Water Solubility:

    Soluble to 1 mg/ml in water

  • Seller Information
    Business Type:

    Trader

    Main Products:

    GLP-1,trizepatide,Semaglutide,Retatrutide

    Location:

    Room 2012, No. 6-143, Section 2, Shanghai Road, Guta District, Jinzhou City, Liaoning Province

    Average lead Time:

    2

    Total Annual Revenue:

    $1 million-$2.5 million

    Total Employees:

    11-50

    Year of Establishment:

    2024

     Daxiang Technology Co., Ltd. is a leading manufacturer and global supplier of high-quality peptide-based pharmaceuticals and fine chemicals. We specialize in the research, development, and production of diverse peptide compounds that meet the rigorous standards of the international pharmaceutical and biotechnology industries.
    Our commitment to excellence is reflected in our strictly GMP-compliant manufacturing facilities, ensuring the highest levels of quality, purity, and consistency in every product.
    We always adhere to market demand as our guide, and continually develop and synthesize new high-tech chemical products.
    Leveraging our global footprint, our products are exported to Europe, the Americas, Southeast Asia, Africa, and other regions, serving customers worldwide.
    Driven by innovation and a customer-centric philosophy, Daxiang Technology Co., Ltd. is dedicated to being your trusted partner for premium peptide solutions, supporting advancements in healthcare and technology worldwide.

  • Country Product Purchase Quantity Date Posted
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.