Product
Supplier
Encyclopedia
Inquiry
Home > Pharmaceutical Intermediates > Bulk Drug Intermediates > LL-37 for Sale > 154947-66-7 Pure LL37 Peptide | PharmaceuticalGrade | Weight Management &Body building Support
154947-66-7 Pure LL37 Peptide | PharmaceuticalGrade | Weight Management &Body building Support buy - large image1
154947-66-7 Pure LL37 Peptide | PharmaceuticalGrade | Weight Management &Body building Support buy - image1
154947-66-7 Pure LL37 Peptide | PharmaceuticalGrade | Weight Management &Body building Support buy - image2
154947-66-7 Pure LL37 Peptide | PharmaceuticalGrade | Weight Management &Body building Support buy - image3
154947-66-7 Pure LL37 Peptide | PharmaceuticalGrade | Weight Management &Body building Support buy - image4
154947-66-7 Pure LL37 Peptide | PharmaceuticalGrade | Weight Management &Body building Support buy - image5
154947-66-7 Pure LL37 Peptide | PharmaceuticalGrade | Weight Management &Body building Support buy - image6

154947-66-7 Pure LL37 Peptide | PharmaceuticalGrade | Weight Management &Body building Support

TDS 1 Inquiries

Unit Price:

$10/BOU FOB

Get Latest Price
CAS No.:

154947-66-7

Grade:

Pharmaceutical Grade

Content:

99%

Port:

hong kong

Brand:

Tranmoo

Packaging:

5mg*10vials

Price valid (until):

2027-02-28

Company Type:
Trader
Location:
China
Qualification:
Main Products:

Retatrutide

  • Product Description

  • Seller Information

  • Inquiry History

  • Description


      Product Detail  


    Contact Information:
    WHATSAPP:+8615875350252

    EMAIL:cting7458@gmail.com

    please add my WhatsApp account to receive more product catalogs!


    1. Company Introduction:

    Our company specializes in exporting various chemical products, including chemical raw materials, a full range of peptide products.

    We will provide you with high quality products at the best offer. Professional transportation, convenient and safe, door-to-door delivery.

    Customers who have ordered our products(peptides)have had very good feedback.

    World wide relaible buyers can contact us about the peptides.

    2. Product Description:

    Peptides are short chains of 2–50 amino acids linked by peptide bonds, bridging amino acids and proteins. They feature high absorption rate (80%–95%), strong biological activity, low immunogenicity, and wide applications in pharmaceuticals, cosmetics, nutraceuticals, and research.

    3. Key Categories:

    - Cosmetic Peptides: Acetyl Hexapeptide-8, Copper Peptide GHK-Cu, Pentapeptide-4, SNAP-8
    - Pharmaceutical Peptides: Semaglutide, Tirzepatide, Thymosin Alpha-1, Epithalon

    4. Specifications:

    - Purity: ≥99% (HPLC)
    - Appearance: White to off-white lyophilized powder
    - Solubility: Soluble in water, DMSO, etc.
    - Storage: -20°C, dry and protected from light
    - Minimum order quantity: 1 box
    - COA provided; factory direct supply; stable quality; fast delivery

    5.  Applications:

    - Cosmetics: Anti-wrinkle, firming, whitening, repair
    - Pharmaceuticals: Weight management, immune regulation
    - Nutritional supplements: Sports nutrition, anti-aging, health supplements
    - Scientific research: Laboratory reagents, custom synthesis


    6. Why Choose Us:

    - Factory direct, competitive FOB price
    - Strict quality control, full COA
    - Custom synthesis & packaging available
    - Fast delivery & professional after-sales

    Contact us for best quotation!


    7. peptides have obvious advantages:

    - Direct absorption without digestion
    - Strong targeting and physiological activity
    - Stable structure, easy to process and formulate
    - High safety, good biocompatibility
    - Suitable for oral, topical and injection applications

    These properties make peptides one of the most promising raw materials in the global health and beauty industry.



    8.Main Functions & Benefits

    - Anti-aging & anti-wrinkle
    Reduce fine lines, firm skin, promote collagen regeneration.
    - Skin repair & protection
    Accelerate wound healing, soothe sensitive skin, reduce inflammation.
    - Weight management & metabolism
    Regulate appetite, improve insulin sensitivity, support fat metabolism.


    We are a professional peptide manufacturer and supplier with rich experience in global export.
    We provide high-quality peptides, stable supply, and professional service for worldwide customers.
    Welcome to contact us for price list, COA and more details.




    FAQ:

    Q1: About the after-sale service

    A: After purchasing the products from our Lab, we have A professional technical team and after-sales team to serve you and solve all your problems in the future

    Q2: How do I start paying?
    Payment methods: USDT, Paypal Bitcoin, bank transfer, Alipay, and WeChat Pay.

    Q3: How to confirm product quality before placing an order?
    You can send us your product specifications and requirements and we can customize for you.

    Q4: What is your MOQ?
    A: The minimum quantity we can order is 1 box.

    Shop 154947-66-7 Pure LL37 Peptide | PharmaceuticalGrade | Weight Management &Body building Support-Detailed Image 1 Shop 154947-66-7 Pure LL37 Peptide | PharmaceuticalGrade | Weight Management &Body building Support-Detailed Image 2 Shop 154947-66-7 Pure LL37 Peptide | PharmaceuticalGrade | Weight Management &Body building Support-Detailed Image 3 Shop 154947-66-7 Pure LL37 Peptide | PharmaceuticalGrade | Weight Management &Body building Support-Detailed Image 4 Shop 154947-66-7 Pure LL37 Peptide | PharmaceuticalGrade | Weight Management &Body building Support-Detailed Image 5 Shop 154947-66-7 Pure LL37 Peptide | PharmaceuticalGrade | Weight Management &Body building Support-Detailed Image 6

    Shop 154947-66-7 Pure LL37 Peptide | PharmaceuticalGrade | Weight Management &Body building Support-Detailed Image 7 Shop 154947-66-7 Pure LL37 Peptide | PharmaceuticalGrade | Weight Management &Body building Support-Detailed Image 8 Shop 154947-66-7 Pure LL37 Peptide | PharmaceuticalGrade | Weight Management &Body building Support-Detailed Image 9
    Shop 154947-66-7 Pure LL37 Peptide | PharmaceuticalGrade | Weight Management &Body building Support-Detailed Image 10
    Shop 154947-66-7 Pure LL37 Peptide | PharmaceuticalGrade | Weight Management &Body building Support-Detailed Image 11

    Items Specifications
    Before ordering Please send what items and what quantity you need
    Send quotation We will send you a quotation in detail with total
    Payment ways chosen Please choose one of the payment way you preferred.
    Payment methods: USDT, Bitcoin, bank transfer, Alipay, and WeChat Pay.
    After payment Please offer shipping address after payment for shipment.
    Tracking We will provide the tracking after goods sent
    After-sale service Available always



    Certificates

    Basic Info
    Product Name:

    LL-37

    Other Name:

    Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

    CAS No.:

    154947-66-7

    Molecular Formula:

    C205H340N60O53

    InChIKeys:

    POIUWJQBRNEFGX-XAMSXPGMSA-N

    Molecular Weight:

    0

    EC Number:

    211-519-9

    Color/Form:

    White to off-white

    Characteristics
    Water Solubility:

    Soluble to 1 mg/ml in water

  • Seller Information
    Business Type:

    Trader

    Main Products:

    Retatrutide

    Location:

    shenzhenshilonggangqulongchengjiedaohuanggekengshequjiazhaoyeshidaidasha902

    Average lead Time:

    15

    Year of Establishment:

    2024

    Shenzhen Chuanmu Technology Co., Ltd .

    Shenzhen Chuanmu Technology Co., Ltd. stands at the forefront of the biotechnology industry as a specialized leader dedicated to the research, development, and sales of high-purity, bioactive peptides. We integrate cutting-edge scientific innovation with an unwavering commitment to quality, serving a global clientele across pharmaceuticals, cosmetics, nutraceuticals, and research institutions.

    Driven by a mission to harness the power of peptides for health and advancement, our core strength lies in our advanced R&D capabilities. Our team of expert scientists utilizes state-of-the-art synthesis, purification, and analytical technologies to produce peptides of exceptional purity, consistency, and biological activity. We offer a comprehensive portfolio, including custom peptide synthesis, catalog peptides, generic APIs, and novel peptide-based formulations tailored to specific client requirements.

    Quality and reliability are the bedrock of our operations. Our processes adhere to the most stringent international standards, ensuring every product meets rigorous specifications for safety and efficacy. We are more than just a supplier; we are a strategic partner, providing robust technical support, confidential collaboration, and scalable solutions from preclinical stages to commercial production.

    Based in the dynamic innovation hub of Shenzhen, China, Shenzhen Chuanmu Technology is poised to accelerate your next breakthrough. We empower our partners to pioneer new treatments, enhance product performance, and push the boundaries of scientific discovery.

    Our Promise: Precision in Every Chain. Innovation for a Healthier Future.

  • Inquiry History
    1 Inquiries
    Country Product Purchase Quantity Date Posted
    Indonesia

    LL-37

    5 MG Jun 23, 2026
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.