Product
Supplier
Encyclopedia
Inquiry
Home > Chemical Reagents > Organic Reagents > LL-37 for Sale > Top 10 Peptides LL-37 High Purity Wholesale Custom Lab Peptide Ghk-cu for Research
Top 10 Peptides LL-37 High Purity Wholesale Custom Lab Peptide Ghk-cu for Research buy - large image1
Top 10 Peptides LL-37 High Purity Wholesale Custom Lab Peptide Ghk-cu for Research buy - image1
Top 10 Peptides LL-37 High Purity Wholesale Custom Lab Peptide Ghk-cu for Research buy - image2
Top 10 Peptides LL-37 High Purity Wholesale Custom Lab Peptide Ghk-cu for Research buy - image3
Top 10 Peptides LL-37 High Purity Wholesale Custom Lab Peptide Ghk-cu for Research buy - image4
Top 10 Peptides LL-37 High Purity Wholesale Custom Lab Peptide Ghk-cu for Research buy - image5
Top 10 Peptides LL-37 High Purity Wholesale Custom Lab Peptide Ghk-cu for Research buy - image6

Top 10 Peptides LL-37 High Purity Wholesale Custom Lab Peptide Ghk-cu for Research

GMP 1 Inquiries

Unit Price:

$8-10/UNIT FOB

Get Latest Price
CAS No.:

154947-66-7

Grade:

Top Grade

Content:

99%

Port:

shenzhen

Brand:

ZHUO SHANG

Packaging:

10vials/box

Price valid (until):

2029-12-31

Company Type:
Trader
Location:
China
Qualification:
Main Products:

Peptides,Pharmaceutical Intermediates,Chemical Reagents

  • Product Description

  • Seller Information

  • Inquiry History

  • Description
    Shop Top 10 Peptides High Purity Tirzepatide Peptide for Research Wholesale Raw Powder-Detailed Image 1


      Product Information  


    Product Name LL-37
    Active ingredients Peptide
    Main efficacy Research
    Type Vials/Capsules/Drops/Power/or Customizable
    Service OEM/ODM/Private Label
    MOQ 500 pieces
    Sample Samples available upon request
    Shelf life between 2-5 years
    Storage Cool and dry
    Package size 30*30*35cm/50pcs or customers' requirement
    Certificate GMP/FDA/COA/HACCP/Halal etc
    Payment method T/T , UC ,Cash etc
    Packaging Options Bulk , bottles , blister packs or customers' requirement
    Shipping DHL , Fedex , UPS , EMS , TNT , by Sea , By air
    Delivery Time 5-15 days after your order is confirmed


      Product Display  


    Shop Top 10 Peptides LL-37 High Purity Wholesale Custom Lab Peptide Ghk-cu for Research-Detailed Image 2
    Shop High Quality Peptides GLOW for Research Powder Wholesale Custom High Purity Peptide-Detailed Image 4
    Shop Top 10 Peptides LL-37 High Purity Wholesale Custom Lab Peptide Ghk-cu for Research-Detailed Image 4
    Shop High Quality Peptides GLOW for Research Powder Wholesale Custom High Purity Peptide-Detailed Image 5
    Shop Wholesale Label Peptides Cerebrolysin for Research Peptides High Purity Chemical Reagent-Detailed Image 6
    Shop Top 10 Peptides High Purity Tirzepatide Peptide for Research Wholesale Raw Powder-Detailed Image 6


      Packaging&Shipping  


    Shop Top 10 Peptides High Purity Tirzepatide Peptide for Research Wholesale Raw Powder-Detailed Image 7
    Shop Top 10 Peptides High Purity Tirzepatide Peptide for Research Wholesale Raw Powder-Detailed Image 8


      Company Profile


    Shop Top 10 Peptides High Purity Tirzepatide Peptide for Research Wholesale Raw Powder-Detailed Image 9


      FAQ  


    1. who are we?

    We are based in Henan, China, start from 2013,sell to North America(60.00%),Eastern Europe(12.00%),Western Europe(10.00%),Southern Europe(5.00%),Northern Europe(3.00%),South Asia(3.00%),Southeast Asia(2.00%),Oceania(2.00%),South America(2.00%),Africa(1.00%). There are total about 11-50 people in our office.

    2. how can we guarantee quality?

    Always a pre-production sample before mass production;
    Always final Inspection before shipment.

    3.what can you buy from us?

    High-purity, high-standard freeze-dried powder.
    Capsules, Tablets, Drops, Gummies, Powder......

    4. why should you buy from us not from other suppliers?

    Henan Zhuo Shang, OEM Supplier, GMP Factory, Your Partner!
    We are Dietary Healthcare Supplements Manufacturer On The Cutting Edge Of All New Technologies In The Health Industry.

    5. what services can we provide?

    Accepted Delivery Terms: FOB,Express Delivery,EXW, DEQ, DDP;
    Accepted Payment Currency:USD, CNY;
    Accepted Payment Type: T/T,L/C,D/P D/A,MoneyGram,Credit Card,Cash,Escrow......
    Language Spoken:English, Chinese, French, Spanish, Russian......

    Certificates

    Basic Info
    Product Name:

    LL-37

    Other Name:

    Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

    CAS No.:

    154947-66-7

    Molecular Formula:

    C205H340N60O53

    InChIKeys:

    POIUWJQBRNEFGX-XAMSXPGMSA-N

    Molecular Weight:

    0

    EC Number:

    211-519-9

    Color/Form:

    White to off-white

    Categories:

    Organic Reagents

    Characteristics
    Water Solubility:

    Soluble to 1 mg/ml in water

  • Seller Information
    Business Type:

    Trader

    Main Products:

    Peptides,Pharmaceutical Intermediates,Chemical Reagents

    Location:

    No. 32 Changxiamen Street, Luolong District, Luoyang City, Henan Province

    Payment Terms:

    TT against copy of documents,D/P,L/C,D/A,O/A,TT against B/L draft before shipment,100% TT in advance

    Average lead Time:

    30

    Total Annual Revenue:

    $5 million-$10 million

    Total Employees:

    11-50

    Year of Establishment:

    2025

    Founded in 2013, Zhuoshang is a GMP-certified Pharmaceutical Intermediates manufacturer specializing in turnkey OEM/ODM solutions for global brands. With our 30000 sqm FDA-registered facility in China, we empower enterprises to launch their own supplement lines with minimum order quantities from just 500 units.

    Our mature R&D-procurement-production-logistics team helps partners complete their business closed loop from 0 to 1.

    At Zhuoshang, we believe premium nutrition shouldn't come at the planet's expense. Our eco-conscious operations include:

    • Zero-waste production: 98%+ raw material utilization through advanced processing and byproduct upcycling.

    • Green packaging: Customizable biodegradable pouches, PCR plastic bottles, and minimalist designs to reduce environmental footprint.

    • Carbon-reducing initiatives: Solar-powered facility segments and optimized logistics networks to cut emissions by 30% vs industry standards.

    We merge scientific rigor with environmental responsibility-because your brand's success should align with a healthier future for all.

  • Inquiry History
    1 Inquiries
    Country Product Purchase Quantity Date Posted
    Indonesia

    LL-37

    5 MG Jun 23, 2026
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.