Product
Supplier
Encyclopedia
Inquiry
Home > Pharmaceutical Intermediates > Bulk Drug Intermediates > LL-37 for Sale > LL-37 SS31 KLOW80 China Fast Delivery In Stock peptide High Purity GHK-CU TB500
LL-37 SS31 KLOW80  China Fast Delivery In Stock  peptide   High Purity GHK-CU  TB500 buy - large image1
LL-37 SS31 KLOW80  China Fast Delivery In Stock  peptide   High Purity GHK-CU  TB500 buy - image1
LL-37 SS31 KLOW80  China Fast Delivery In Stock  peptide   High Purity GHK-CU  TB500 buy - image2
LL-37 SS31 KLOW80  China Fast Delivery In Stock  peptide   High Purity GHK-CU  TB500 buy - image3
LL-37 SS31 KLOW80  China Fast Delivery In Stock  peptide   High Purity GHK-CU  TB500 buy - image4
LL-37 SS31 KLOW80  China Fast Delivery In Stock  peptide   High Purity GHK-CU  TB500 buy - image5
LL-37 SS31 KLOW80  China Fast Delivery In Stock  peptide   High Purity GHK-CU  TB500 buy - image6

LL-37 SS31 KLOW80 China Fast Delivery In Stock peptide High Purity GHK-CU TB500

TDS

Unit Price:

$14-16/UNIT FOB

Get Latest Price
CAS No.:

154947-66-7

Grade:

Pharmaceutical Grade

Content:

99%

Port:

hongkong

Brand:

Customization Available

Packaging:

10mg*10vials/box

Price valid (until):

2026-06-18

Company Type:
Trader
Location:
China
Qualification:
Main Products:

Retatrutide,Tirzepatide,GLOW,KLOW80,NAD+,TB500

  • Product Description

  • Seller Information

  • Description

    contact information:

    Email address:ling2924@outlook.com

    Whatsapp:+85266364037



      Guangzhou Duorun Trading Company  



      Product Detail  


      Tirzepatide (M-ounjaro) is a novel medication indicated as an adjunct to diet and exercise in the treatment of patients with type 2 diabetes mellitus. Tirzepatide is a dual receptor agonist, acting on glucose-dependent insulinotropic polypeptide (GIP) and glucagon-like peptide-1 (GLP-1) to lower blood glucose levels.
      Tirzepatide is a dual glucose-dependent insulinotropic polypeptide (GIP) and GLP-1 agonist that has been studied recently as a treatment for patients with noncirrhotic NASH (SYNERGY-NASH, NCT04166773) given its association with significant weight loss and improvement in features of metabolic syndrome in diabetes trials.

    Shop SS31 KLOW80  China Fast Delivery In Stock  peptide   High Purity GHK-CU  TB500-Detailed Image 1

    Product Function

      The addition of GIP which anatagonizes the central effects of GLP-1 to cause nausea is designed to improve tolerability and also allow for more aggressive dosing with increased systemic exposure. A recent post-hoc analysis showed significantly decreased NASH-related biomarkers and increased adiponectin in patients with T2DM

      The weight-reducing actions of the GIPR-GLP1R co-agonist tirzepatide.Considerable interest is focused on the mechanisms of action of tirzepatide, a highly effective GIPR-GLP1R co-agonist that produces superior reductions in HbA1c and body weight, relative to that achieved with 1 mg once weekly of semaglutide in people with T2D. The GIPR is expressed in multiple regions of the mouse and human brain, in subsets of neurons and glial cells, with some hypothalamic and hindbrain cells exhibiting co-expression of the GIPR and GLP1R. Chemogenetic activation of GIPR + cells in the mouse hypothalamus acutely reduced food intake; however, co-administration of exendin-4 did not produce an additive reduction of food intake when compared to either intervention alone.

      Therapy with tirzepatide, 5-15 mg once weekly produces 8-12% body weight reduction in people with T2D, prompting ongoing development of tirzepatide as a weight loss agent for people with overweight or obesity. The importance of GIP for the weight loss properties of tirzepatide in humans is uncertain; however, tirzepatide failed to reduce body weight in Glp1r−/- mice, implicating a dominant role for the GLP1R in the weight loss observed with this agent. Glucose-dependent insulinotropic polypeptide (GIP) has been shown to reduce the extent of aversive responses induced by GLP-1 in mice and rats and decrease nausea and vomiting in the shrew.

    Product Application

    •1.Helps slow food leaving your stomach
    • 2.Helps prevent your liver from making too much sugar
    • 3.Helps the pancreas produce more insul when your blood sugar levels are high
    • 4.Can help control blood glucose
    • 5.Can reduce hyperglycemia, especially after meals
    • 6.Can reduce fasting insul and fasting glucose
    • 7.Can reduce hemoglobin A1c
    • 8.Can decrease appetite and caloric intake, while inhibiting weight gain
    • 9.Has been shown to lower triglyceride levels and oxidative stress from high LDL

    Peptide Storage Guidelines: General Tips
    When storing peptides, remember to:
    • Store peptide in a cold, dry, dark place
    • Avoid repeated freezing and thawing of peptide
    • Avoid overexposure to the air
    • Avoid light exposure
    • Avoid storing peptides in solution long term
    • Aliquot peptide according to experimental requirements

    Company Profile

      Our company is a modern advanced enterprise specializing in production and exportation of APIs, Pharmaceutical intermediates, plant extracts etc. Our products are widely used in medicine, health care products, cosmetics, nutritional supplements and food additives areas. Our factory covers an area of 95 acres, the proposed construction of the plant will be GMP standards, the factory environment clean and tidy, rational layout, with large and medium-sized production workshop and repocessed shop. It is equipped with advanced equipment quality inspection and research center. Those products of both quality and technical content have reached the domestic advanced level. Since its establishment, the company has attached great importance to the team training and technical reform. Our modern production equipment guarantees for a fast and effective production with a superior degree of accuracy throughout the whole production line, everything is done in-house, processing, extraction, packaging and transportation of all links, ensuring maximum quality and efficiency. We are constantly research and development new ingredients and innovative new products, have earned the respect & Admiration from the worldwide customers. After years of continuous development, company has been accumulated rich experience in international trade and customer resources, established a stable customer base and perfect marketing service network. In addition, the company has established long-term technical cooperation with experts and professors from many universities and research institutes in the province.


    Items Specifications
    Apperance Powder
    Key words H10
    Function Weight Loss
    Shop SS31 KLOW80  China Fast Delivery In Stock  peptide   High Purity GHK-CU  TB500-Detailed Image 2

    Shop SS31 KLOW80  China Fast Delivery In Stock  peptide   High Purity GHK-CU  TB500-Detailed Image 3
    Shop SS31 KLOW80  China Fast Delivery In Stock  peptide   High Purity GHK-CU  TB500-Detailed Image 4
    Shop SS31 KLOW80  China Fast Delivery In Stock  peptide   High Purity GHK-CU  TB500-Detailed Image 5 Shop SS31 KLOW80  China Fast Delivery In Stock  peptide   High Purity GHK-CU  TB500-Detailed Image 6
    Shop SS31 KLOW80  China Fast Delivery In Stock  peptide   High Purity GHK-CU  TB500-Detailed Image 7 Shop SS31 KLOW80  China Fast Delivery In Stock  peptide   High Purity GHK-CU  TB500-Detailed Image 8
    Shop SS31 KLOW80  China Fast Delivery In Stock  peptide   High Purity GHK-CU  TB500-Detailed Image 9


    Why choose us?

    Shop SS31 KLOW80  China Fast Delivery In Stock  peptide   High Purity GHK-CU  TB500-Detailed Image 10 Shop SS31 KLOW80  China Fast Delivery In Stock  peptide   High Purity GHK-CU  TB500-Detailed Image 11 Shop SS31 KLOW80  China Fast Delivery In Stock  peptide   High Purity GHK-CU  TB500-Detailed Image 12


    Certificates
    • LL-37 SS31 KLOW80  China Fast Delivery In Stock  peptide   High Purity GHK-CU  TB500 Certificates 1

    Basic Info
    Product Name:

    LL-37

    Other Name:

    Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

    CAS No.:

    154947-66-7

    Molecular Formula:

    C205H340N60O53

    InChIKeys:

    POIUWJQBRNEFGX-XAMSXPGMSA-N

    Molecular Weight:

    0

    EC Number:

    211-519-9

    Color/Form:

    White to off-white

    Characteristics
    Water Solubility:

    Soluble to 1 mg/ml in water

  • Seller Information
    Business Type:

    Trader

    Main Products:

    Retatrutide,Tirzepatide,GLOW,KLOW80,NAD+,TB500

    Location:

    Room 11B, Building 0056, No. 81-1 Nonglinxia Road, Yuexiu District, Guangzhou City, Guangdong Province

    Total Annual Revenue:

    $1 million-$2.5 million

    Total Employees:

    5-10

    Year of Establishment:

    2026

  • Country Product Purchase Quantity Date Posted
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.