Product
Supplier
Encyclopedia
Inquiry
Home > Cosmetic Ingredient > Anticaking > LL-37 for Sale > LL-37 CAS154947-66-7 The best price The price is the factory price Factory quotation
LL-37 CAS154947-66-7  The best price  The price is the factory price  Factory quotation buy - large image1
LL-37 CAS154947-66-7  The best price  The price is the factory price  Factory quotation buy - image1
LL-37 CAS154947-66-7  The best price  The price is the factory price  Factory quotation buy - image2
LL-37 CAS154947-66-7  The best price  The price is the factory price  Factory quotation buy - image3
LL-37 CAS154947-66-7  The best price  The price is the factory price  Factory quotation buy - image4
LL-37 CAS154947-66-7  The best price  The price is the factory price  Factory quotation buy - image5
LL-37 CAS154947-66-7  The best price  The price is the factory price  Factory quotation buy - image6

LL-37 CAS154947-66-7 The best price The price is the factory price Factory quotation

TDS

Unit Price:

$1/G FOB

Get Latest Price
CAS No.:

154947-66-7

Grade:

Pharmaceutical Grade

Content:

99%

Port:

shenzhen

Brand:

SC

Packaging:

5 mg /10 mg / 15 mg / 20 mg / 30 mg / 10 tubes per box

Price valid (until):

2026-10-15

Company Type:
Trader
Location:
Hongkong, China
Qualification:
Main Products:

tr

  • Product Description

  • Seller Information

  • Description


      Product Detail  


    Sales manager: Freya

    WhatsApp:+85244869948

    Shop LL-37 CAS154947-66-7  The best price  The price is the factory price  Factory quotation-Detailed Image 1

    Why Choose Us
    •High quality products: We have rich experience in production and processing, strict quality inspection.

    •Reasonable prices: Factory direct, reasonable price and negotiable.

    •Processing customization: OEM/ODM is acceptable, at the same time, we support the customization of product specifications

    •Quick response: We will reply to your message within 24 hours.

    •Good after-sales service: we have a professional team to solve the problems you encounter in the process of using the products.

    Shop LL-37 CAS154947-66-7  The best price  The price is the factory price  Factory quotation-Detailed Image 2

    FAQ


    Q1.Can I have a sample order?

    A: Yes, welcome to place an sample order to check quality or market.

    Q2.What's the sample and goodslead time?

    A:The stock sample for l day,custom sample for 7-10 days,bulk order for 20-25 days.

    Q3.Do you have any MOQ limit?

    A:yes,the MOQ is 100pcs but any trial order is welcome.

    Q4.How do you ship the goods and how long does it take to arrive?

    A:According to your order quantity,usually ship by sea or by air and by express,20-30 days by sea,5-7 days by air and 3-5 days byexpress.

    Q5.How to proceed an order?

    A: Firstly let us know your requirements. Secondly We quote according to your requirements or our suggestions. Thirdly customer confirm the artworks and pay deposit for formal order.Fourthly We arrange the production & shipment then you pay balance to us.

    Q6.Is it OK to print my logo on the product?

    A: Yes.Please provide the logo Al file so that our designer can make the mock up for you approval.

    Q7: Can you support custom packing?

    A: Sure,custom poly bag with warning text,gift box or display box is welcome.es.

    Shop LL-37 CAS154947-66-7  The best price  The price is the factory price  Factory quotation-Detailed Image 3

    FAQ

    1. About Our Company
    Q: Are you a direct manufacturer or a distributor? A: We operate as both—a certified peptide manufacturer and global supplier, ensuring quality control from production to delivery.

    2. Payment Options
    Q: Which payment methods do you support? A: We accept multiple secure options, including cryptocurrency (BTC/USDT), international wire transfers, and traditional remittance services.

    3. Shipping & Delivery
    Q: What is the estimated delivery time? A: Orders are typically delivered within 7-15 working days via express couriers (DHL/UPS/FedEx) or air freight. Sea shipping is available for bulk orders.

    4. Logistics Partners
    Q: Which carriers do you work with? A: We partner with major logistics providers (EMS, TNT, China Air Post) and accommodate custom freight requests.

    5. Order Quantity

    Q: Is there a minimum order requirement? A: Standard products start at 1 box; customized peptides require 10-50 boxes (MOQ varies by formulation).

    6. Bulk Pricing
    Q: Do you offer discounts for large orders? A: Yes—contact us for tiered pricing based on volume.

    7. Custom Branding

    Q: Can I add my logo to the packaging? A: Absolutely. Submit your logo design (AI/vector file), and we’ll provide a mockup for approval.

    8. Global Reach

    Q: Where do you export to? A: We serve clients worldwide, complying with international shipping regulations.

    Shop LL-37 CAS154947-66-7  The best price  The price is the factory price  Factory quotation-Detailed Image 4


    Our products enjoy good reputation both at home and abroad. Our trade partners are around the world, mainly in America,Europe,Australia,South East Asia ,Middle East and South Africa. In order to serve customers well, the company has established special technical department and after-sale service department. We will make careful reply if you get any question.

    The company with all the employees will constantly purse excellent quality, perfect brand and our image, and adheres to our spirit of honesty, diligence, seeking truth and progress and insists on business philosophy of quality as life and service as soul. We will satisfy market demands by top products and better service, and will welcome market challenge forever.

    Shop LL-37 CAS154947-66-7  The best price  The price is the factory price  Factory quotation-Detailed Image 5

    1. Ultra-High Purity
    Each batch is synthesized and purified to >99% purity (HPLC), ensuring reliable and reproducible results in sensitive experiments.

    2.Accurate Dosing & Consistency
    Our peptides are precisely weighed and vacuum-sealed under sterile conditions. Batch-to-batch consistency is rigorously maintained.

    3.Endotoxin-Free & Sterile Processing
    Manufactured in a cleanroom environment, our peptides are free from endotoxins, microbial contamination, and other impurities that could interfere with cell-based or in vivo studies.

    4. Advanced Manufacturing Capabilities

    Cutting-Edge Facilities: High-precision equipment ensuring purity and bioactivity.

    Scalable Production: From milligram-scale research peptides to multi-kilogram industrial batches.

    5. Innovation & Customer Commitment

    Reliable Supply Chain: Competitive pricing & timely global delivery.

    Global Reach: Trusted by researchers, pharmaceutical firms & industrial clients worldwide.

    Shop LL-37 CAS154947-66-7  The best price  The price is the factory price  Factory quotation-Detailed Image 6

    Our Advantages


    ‌1. Quality assurance:

    factory-produced, good quality, batch purity ≥ 99%, stability data report, free COA.++

    ‌2. Product advantages:

    According to the different actual conditions of customers, we can meet customers' customized needs, including but not limited to product ingredients, label customization, and lid color. Flexible to meet diversified needs.

    ‌3. Service added value:

    Super-speed delivery‌: Regular sequence delivery within 7-14 working days, urgent orders can be expedited to 5 working days (without any expedited fee), ‌Global worry-free logistics‌: DDP customs clearance service covers more than 100 countries including Europe and the United States, Technical empowerment‌: Free reconstitution advice, storage solutions and structural optimization consultation. Make R&D procurement more efficient and worry-free

    4. Cooperation Guarantee:

    Price competitiveness‌: Own synthesis platform + large-scale production, the price of the same purity is 40-60% lower than that of European and American suppliers. Flexible cooperation model‌: Support small batch trial orders and signing of confidentiality agreements for patented peptides. Quality commitment‌: Re-shipment in case of problems, controllable risks and cost optimization.


    Shop LL-37 CAS154947-66-7  The best price  The price is the factory price  Factory quotation-Detailed Image 7

    Our core advantages lie in a dual guarantee system:

    Comprehensive quality control across the entire product lifecycleFrom the strict screening of raw materials, standardized production processes to multiple rounds of quality inspections before delivery, we ensure every product meets quality standards higher than industry benchmarks. This guarantees you a stable, reliable user experience and long-term value.
    A robust after-sales support systemEquipped with a professional customer service team and rapid response mechanism, we commit to replying to customer inquiries within 24 hours and providing solutions within 72 hours. Whether it's product consultation, usage guidance, or after-sales maintenance, our systematic processes ensure service efficiency and quality, letting you enjoy a worry-free consumption experience.

    Shop LL-37 CAS154947-66-7  The best price  The price is the factory price  Factory quotation-Detailed Image 8

    Main Export Markets

    Main Export Markets
    Central/South America, 
    Eastern Europe, 
    Mid East/Africa, 
    North America, 
    Western Europe, 
    Asia, 
    Australasia

    Shop LL-37 CAS154947-66-7  The best price  The price is the factory price  Factory quotation-Detailed Image 9


    Transportation

    Shop LL-37 CAS154947-66-7  The best price  The price is the factory price  Factory quotation-Detailed Image 10 Shop LL-37 CAS154947-66-7  The best price  The price is the factory price  Factory quotation-Detailed Image 11 Shop LL-37 CAS154947-66-7  The best price  The price is the factory price  Factory quotation-Detailed Image 12 Shop LL-37 CAS154947-66-7  The best price  The price is the factory price  Factory quotation-Detailed Image 13 Shop LL-37 CAS154947-66-7  The best price  The price is the factory price  Factory quotation-Detailed Image 14

    Payment Details
    Payment Method PayPal

    Certificates
    • LL-37 CAS154947-66-7  The best price  The price is the factory price  Factory quotation Certificates 1

    Basic Info
    Product Name:

    LL-37

    Other Name:

    Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

    CAS No.:

    154947-66-7

    Molecular Formula:

    C205H340N60O53

    InChIKeys:

    POIUWJQBRNEFGX-XAMSXPGMSA-N

    Molecular Weight:

    0

    EC Number:

    211-519-9

    Color/Form:

    White to off-white

    Categories:

    Anticaking

    Characteristics
    Water Solubility:

    Soluble to 1 mg/ml in water

  • Seller Information
    Business Type:

    Trader

    Main Products:

    tr

    Location:

    B27 SHING LEE COMM BLDG 8WING KUT ST CENTRAL HONGKONG

    Total Annual Revenue:

    Less than $1 million

    Total Employees:

    5-10

    Year of Establishment:

    2026

  • Country Product Purchase Quantity Date Posted
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.