Product
Supplier
Encyclopedia
Inquiry
Home > Cosmetic Ingredient > Abrasive > LL-37 for Sale > TB500 Thymosin B4 Acetate LL37 CAS154947-66-7 GHK-CU NAD+ BT5 BT10 375 CU50 CU100 NJ100 NJ500 NJ1000 factory outlet
TB500 Thymosin B4 Acetate LL37 CAS154947-66-7 GHK-CU NAD+ BT5 BT10 375 CU50 CU100 NJ100 NJ500 NJ1000 factory outlet buy - large image1
TB500 Thymosin B4 Acetate LL37 CAS154947-66-7 GHK-CU NAD+ BT5 BT10 375 CU50 CU100 NJ100 NJ500 NJ1000 factory outlet buy - image1
TB500 Thymosin B4 Acetate LL37 CAS154947-66-7 GHK-CU NAD+ BT5 BT10 375 CU50 CU100 NJ100 NJ500 NJ1000 factory outlet buy - image2
TB500 Thymosin B4 Acetate LL37 CAS154947-66-7 GHK-CU NAD+ BT5 BT10 375 CU50 CU100 NJ100 NJ500 NJ1000 factory outlet buy - image3
TB500 Thymosin B4 Acetate LL37 CAS154947-66-7 GHK-CU NAD+ BT5 BT10 375 CU50 CU100 NJ100 NJ500 NJ1000 factory outlet buy - image4
TB500 Thymosin B4 Acetate LL37 CAS154947-66-7 GHK-CU NAD+ BT5 BT10 375 CU50 CU100 NJ100 NJ500 NJ1000 factory outlet buy - image5
TB500 Thymosin B4 Acetate LL37 CAS154947-66-7 GHK-CU NAD+ BT5 BT10 375 CU50 CU100 NJ100 NJ500 NJ1000 factory outlet buy - image6

TB500 Thymosin B4 Acetate LL37 CAS154947-66-7 GHK-CU NAD+ BT5 BT10 375 CU50 CU100 NJ100 NJ500 NJ1000 factory outlet

TDS

Unit Price:

$1/G FOB

Get Latest Price
CAS No.:

154947-66-7

Grade:

Pharmaceutical Grade

Content:

99%

Port:

shenzhen

Brand:

sc

Packaging:

5mg/10mg/100mg/500mg/1000mg. 10 bottles per box

Price valid (until):

2027-10-31

Company Type:
Trader
Location:
Hongkong, China
Qualification:
Main Products:

tr

  • Product Description

  • Seller Information

  • Description

    Sales manager: Sofia

    WhatsApp:+85244569741

    Sincerely look forward to your inquiries about our products.


    ——      Product Detail      ——

    Our products are widely used in life science research, drug discovery, cosmetics, anti-aging medicine, and functional health industries.

    1. Superior Product Quality

    Product quality is the foundation of our business. Peptides are synthesized using solid-phase peptide synthesis (SPPS), then purified through HPLC and confirmed by mass spectrometry (MS).

    Each batch includes a Certificate of Analysis (COA) with key data:
    • Purity (HPLC)
    • Molecular weight (MS)
    • Water content
    • Residual solvents
    • Microbial limit (if applicable)

    For clients with higher regulatory demands, we also provide third-party testing reports, endotoxin (LAL) data, and stability studies upon request.

    2. Customization & R&D Support

    We offer flexible custom synthesis services, supported by an experienced R&D team. Whether you’re looking for novel peptide sequences, cosmetic-grade purity, or modified molecules (e.g., PEGylation, acetylation), we can deliver high-quality results on time.

    Our services include:
    • Custom peptide synthesis (mg to kg scale)
    • Peptide modifications and labeling
    • Small molecule synthesis
    • Project-based research and scale-up

    We work closely with our clients to ensure technical feasibility, fast delivery, and cost control throughout the development cycle.

    3. Wide Product Portfolio

    We supply a comprehensive and expanding product range:
    • Peptides: GLP-1 analogs (e.g., Semaglutide, Tirzepatide, Retatrutide), cosmetic peptides (e.g., Acetyl Hexapeptide-8, Matrixyl), anti-aging peptides, research peptides.
    • Small Molecules: Nootropics, NAD+ boosters (e.g., NMN, NR, NADH), and intermediates.
    • Biochemicals: Amino acid derivatives, enzyme co-factors, custom reagents.

    New products are launched regularly to meet evolving market needs. We also support batch reservations for clients with ongoing or seasonal demand.

    Shop Pinealon PI5 PI10 P20 Mazdutide Survodutide MZ SUR10 Quality guarantee factory outlet-Detailed Image 2

    Shop Retatrutide CAS2381089-83-2 RT5 RT10 RT15 RT20 RT30 RT40 RT50 RT60 Tirzepatide Peptides Weight Loss Peptide-Detailed Image 2 Shop Retatrutide CAS2381089-83-2 RT5 RT10 RT15 RT20 RT30 RT40 RT50 RT60 Tirzepatide Peptides Weight Loss Peptide-Detailed Image 3

    ——      Why Choose Us      ——

    1.We have more than 10 years of experience in the field of chemical industry, the company's products are exported to more than 60 countries overseas, of which 80% are exported to Europe and America, 20% are exported to Southeast Asia, the Middle East, South Africa and other regions.

    2.We have our own production plant and R & D center, to provide customers with technical support, product customization, free recipes and other whole industry chain services. Support full video inspection, testing, global delivery package.

    3.We accept sample orders for testing, after purchasing products from our factory, we have a professional technical team and after-sales team to serve you and solve all your future problems. 100% quality assurance, 100% safe delivery.

    Shop Retatrutide CAS2381089-83-2 RT5 RT10 RT15 RT20 RT30 RT40 RT50 RT60 Tirzepatide Peptides Weight Loss Peptide-Detailed Image 4

    ——      Our advantage    ——

    We offer various types of peptides, about peptides, we can offer good quality, good price. Customers who have ordered our products (peptides) have received very good feedback. Reliable buyers around the world can contact us about peptides

    1. Ultra-low temperature freezing: Freeze the highly active ingredients at -196 degrees to put the active ingredients into a dormant state.

    2. Effective regeneration: Add the solvent to the powder when using it, and it can be effectively regenerated after mixing, ensuring the high activity and high stability of the product. We offer various types of peptides, and we can provide excellent quality and preferential prices for peptides. The feedback from customers who have ordered our products (peptides) is very good. Reliable buyers around the world can contact us for peptide matters. We offers an unparalleled combination of quality, performance and value. If you have any questions about this product or want to learn more about how it can benefit your business, please feel free to contact us. We are committed to providing excellent customer service and helping our customers achieve their business goals.We look forward to the opportunity to work with you and help you succeed.

    Shop Retatrutide CAS2381089-83-2 RT5 RT10 RT15 RT20 RT30 RT40 RT50 RT60 Tirzepatide Peptides Weight Loss Peptide-Detailed Image 5

    ——      Storage Conditions     ——

    Peptide Storage Guidelines: General Tips

    When storing peptides, remember to:
    • Store peptide in a cold, dry, dark place
    • Avoid repeated freezing and thawing of peptide
    • Avoid overexposure to the air
    • Avoid light exposure
    • Avoid storing peptides in solution long term
    • Aliquot peptide according to experimental requirements

    Shop Retatrutide CAS2381089-83-2 RT5 RT10 RT15 RT20 RT30 RT40 RT50 RT60 Tirzepatide Peptides Weight Loss Peptide-Detailed Image 6 Shop Retatrutide CAS2381089-83-2 RT5 RT10 RT15 RT20 RT30 RT40 RT50 RT60 Tirzepatide Peptides Weight Loss Peptide-Detailed Image 7 Shop Retatrutide CAS2381089-83-2 RT5 RT10 RT15 RT20 RT30 RT40 RT50 RT60 Tirzepatide Peptides Weight Loss Peptide-Detailed Image 8

    ——       Our factory      ——

    We are a high-tech enterprise focusing on the research, development and production of peptide products. The company was established in recent years and is committed to applying advanced biotechnology to the health industry to meet the market's demand for high-quality, high-efficiency peptide products.
    As a leading peptide manufacturer,We have a R&D team composed of senior scientists and engineers, which continues to explore and innovate, and is committed to developing safer, more effective, and more market-competitive peptide products. The company's main products cover but are not limited to pharmaceutical grade, food grade and cosmetic grade and other fields, and are widely used in many aspects such as health care, disease prevention, beauty and skin care.
    In terms of production technology, We adopt internationally advanced production equipment and technology to ensure that every aspect of the product, from raw material selection, production and processing to finished product packaging, strictly follows relevant national standards and specifications to ensure product quality and safety. At the same time, the company has also established a complete quality management system and after-sales service system to provide customers with all-round, one-stop service support.
    Our company adhere to the corporate philosophy of "technology leads health, quality creates the future" and always adheres to the development path of people-oriented and technological innovation. The company not only focuses on product quality and innovation, but also actively fulfills its social responsibilities and is committed to promoting the development and progress of the health industry.
    In the future,We will continue to delve into the field of peptide product research and development, continue to explore and make breakthroughs, and strive to become a leader in the global peptide industry and make greater contributions to human health.

    Shop Retatrutide CAS2381089-83-2 RT5 RT10 RT15 RT20 RT30 RT40 RT50 RT60 Tirzepatide Peptides Weight Loss Peptide-Detailed Image 9 Shop Retatrutide CAS2381089-83-2 RT5 RT10 RT15 RT20 RT30 RT40 RT50 RT60 Tirzepatide Peptides Weight Loss Peptide-Detailed Image 10 Shop Retatrutide CAS2381089-83-2 RT5 RT10 RT15 RT20 RT30 RT40 RT50 RT60 Tirzepatide Peptides Weight Loss Peptide-Detailed Image 11

    ——        Customer Feedback       ——

    Shop Retatrutide CAS2381089-83-2 RT5 RT10 RT15 RT20 RT30 RT40 RT50 RT60 Tirzepatide Peptides Weight Loss Peptide-Detailed Image 12 Shop Retatrutide CAS2381089-83-2 RT5 RT10 RT15 RT20 RT30 RT40 RT50 RT60 Tirzepatide Peptides Weight Loss Peptide-Detailed Image 13

    ——      Packing & Delivery     ——

    Shop Retatrutide CAS2381089-83-2 RT5 RT10 RT15 RT20 RT30 RT40 RT50 RT60 Tirzepatide Peptides Weight Loss Peptide-Detailed Image 14

    Shop Retatrutide CAS2381089-83-2 RT5 RT10 RT15 RT20 RT30 RT40 RT50 RT60 Tirzepatide Peptides Weight Loss Peptide-Detailed Image 15

    Shop Retatrutide CAS2381089-83-2 RT5 RT10 RT15 RT20 RT30 RT40 RT50 RT60 Tirzepatide Peptides Weight Loss Peptide-Detailed Image 16 Shop Retatrutide CAS2381089-83-2 RT5 RT10 RT15 RT20 RT30 RT40 RT50 RT60 Tirzepatide Peptides Weight Loss Peptide-Detailed Image 17

    Welcome to be our distinguished customer

      please do not hesitate to contact us!

    Certificates
    • TB500 Thymosin B4 Acetate LL37 CAS154947-66-7 GHK-CU NAD+ BT5 BT10 375 CU50 CU100 NJ100 NJ500 NJ1000 factory outlet Certificates 1

    Basic Info
    Product Name:

    LL-37

    Other Name:

    Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

    CAS No.:

    154947-66-7

    Molecular Formula:

    C205H340N60O53

    InChIKeys:

    POIUWJQBRNEFGX-XAMSXPGMSA-N

    Molecular Weight:

    0

    EC Number:

    211-519-9

    Color/Form:

    White to off-white

    Categories:

    Abrasive

    Characteristics
    Water Solubility:

    Soluble to 1 mg/ml in water

  • Seller Information
    Business Type:

    Trader

    Main Products:

    tr

    Location:

    B27 SHING LEE COMM BLDG 8WING KUT ST CENTRAL HONGKONG

    Total Annual Revenue:

    Less than $1 million

    Total Employees:

    5-10

    Year of Establishment:

    2026

  • Country Product Purchase Quantity Date Posted
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.