Product
Supplier
Encyclopedia
Inquiry
Home > Pharmaceutical Intermediates > Bulk Drug Intermediates > LL-37 for Sale > LL37 99% freeze dried powder Peptide factory supplier at wholesale price
LL37 99% freeze dried powder Peptide factory supplier at wholesale price buy - large image1
LL37 99% freeze dried powder Peptide factory supplier at wholesale price buy - image1
LL37 99% freeze dried powder Peptide factory supplier at wholesale price buy - image2
LL37 99% freeze dried powder Peptide factory supplier at wholesale price buy - image3
LL37 99% freeze dried powder Peptide factory supplier at wholesale price buy - image4
LL37 99% freeze dried powder Peptide factory supplier at wholesale price buy - image5
LL37 99% freeze dried powder Peptide factory supplier at wholesale price buy - image6

LL37 99% freeze dried powder Peptide factory supplier at wholesale price

Unit Price:

$10-12/MT FOB

Get Latest Price
CAS No.:

154947-66-7

Grade:

Cosmetics Grade

Content:

99%

Port:

SHENZHEN/HONGKONG

Brand:

Boruimei-14

Packaging:

10 vials/box

Price valid (until):

2026-07-05

Company Type:
Trader
Location:
China
Qualification:
Main Products:

Polypeptide Products

  • Product Description

  • Seller Information

  • Description


      Company Profile  


    Jinan Boruimei Trading Co., Ltd.  Professional Peptide Manufacturer, Facilitating Innovation in Life Sciences As a high-tech enterprise deeply involved in the field of peptides, Libilitai Biotechnology Company focuses on the research, production, and customized services of high-quality peptides. With its outstanding technical strength and strict quality control system, the company provides reliable peptide products and solutions to global research institutions, pharmaceutical companies, and biotechnology companies.Strong capabilities, establishing the foundation of quality.

    Shop China Factory Direct Supply 5-Amino-1MQ Lyophilized Powder Used to Preserve Muscle at Discount Price-Detailed Image 1


      Product Detail  


    Product Name LL37
    Parametric 5mg
    Purity ≥99%
    Certificate COA
    Payment PayPal/TT/CC/BTC/USDT/Alipay
    Delivery Time 7-8 days(air express)

    •Peptide Form: Freeze-dried powder
    Peptide Packaging: 10 bottles per box
    Peptide Purity: 99%
    Minimum Order Quantity: 1 box (10 vials)
    Shop China Factory Direct Supply 5-Amino-1MQ Lyophilized Powder Used to Preserve Muscle at Discount Price-Detailed Image 2
    Shop China Factory Direct Supply 5-Amino-1MQ Lyophilized Powder Used to Preserve Muscle at Discount Price-Detailed Image 3


      FAQ


    1.Q:What is your production cycle and delivery schedule?

    A:For regular products, the delivery cycle is usually 3 to 7 days. We also have buffer stocks of key materials to ensure a stable and continuous supply.

    2. Q: What are your main export markets?

    A:Our products are sold all over the world, including the United States, Canada, Australia, the Netherlands, New Zealand, Italy, France, Germany, Mexico and many other countries and regions.

    3. Q: How do you handle the after-sales service and quality issues?

    A:In case of any issues related to quality, transportation or documentation, our team will promptly communicate and provide effective solutions to safeguard the interests of our customers.

    4. Q: How is the quality of the product?

    A: Before each batch of our products is put on the market for sale, they will undergo corresponding quality inspections to ensure that the purity is above 99% and there will be corresponding test reports for reference.

    5. Q: How to make the payment?

    A: Bitcoin, USDT, PayPal


      Why choose us  


    1.High Purity Our peptide products undergo advanced purification processes, achieving extremely high purity with minimal impurity content. This ensures the stability and effectiveness of the products, making them a reliable choice for various applications, such as scientific research, beauty skincare, and healthcare. Whether for academic research or commercial use, our products offer a quality guarantee.
    2.Strong Activity Through our unique production process, we maximize the retention of biological activity in peptides, allowing them to be quickly absorbed and utilized by the human body to exert their full effects. For example, in beauty skincare, active peptides promote collagen production and improve skin elasticity. In healthcare, peptides enhance immunity and regulate body functions.
    3.Customization Service We have a professional R&D team that can customize and synthesize various peptides with specific sequences and functions based on your needs. Whether it's for drug research and development, biological detection, or other specialized fields, we can meet your personalized requirements.
    4.Price We combine industry and trade, and with 12 years of experience, we are able to provide competitive prices and high-quality products.
    5.Packaging & Transportation We can package according to customer requirements and customize products. For transportation, we handle door-to-door delivery, eliminating the need for you to manage any customs clearance.
    Shop China Factory Direct Supply 5-Amino-1MQ Lyophilized Powder Used to Preserve Muscle at Discount Price-Detailed Image 4


      Shipping/Payment  


    Shop China Factory Direct Supply 5-Amino-1MQ Lyophilized Powder Used to Preserve Muscle at Discount Price-Detailed Image 5

    Basic Info
    Product Name:

    LL-37

    Other Name:

    Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

    CAS No.:

    154947-66-7

    Molecular Formula:

    C205H340N60O53

    InChIKeys:

    POIUWJQBRNEFGX-XAMSXPGMSA-N

    Molecular Weight:

    0

    EC Number:

    211-519-9

    Color/Form:

    White to off-white

    Characteristics
    Water Solubility:

    Soluble to 1 mg/ml in water

  • Seller Information
    Business Type:

    Trader

    Main Products:

    Polypeptide Products

    Location:

    No. 917, 9th Floor, Unit 1, Building 19, Shengshi Huayuan Business Center, Shunhua Road Sub-district, High-tech Zone, Jinan City, Shandong Province

    Total Annual Revenue:

    Less than $1 million

    Total Employees:

    5-10

    Year of Establishment:

    2026

  • Country Product Purchase Quantity Date Posted
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.