Product
Supplier
Encyclopedia
Inquiry
Home > Pharmaceutical Intermediates > Bulk Drug Intermediates > LL-37 for Sale > LL37 | US Warehouse | Cosmetic Peptides | 99% Purity | 5mg 10mg Vials | Lyophilized Powder
LL37 | US Warehouse | Cosmetic Peptides | 99% Purity | 5mg 10mg Vials | Lyophilized Powder buy - large image1
LL37 | US Warehouse | Cosmetic Peptides | 99% Purity | 5mg 10mg Vials | Lyophilized Powder buy - image1
LL37 | US Warehouse | Cosmetic Peptides | 99% Purity | 5mg 10mg Vials | Lyophilized Powder buy - image2
LL37 | US Warehouse | Cosmetic Peptides | 99% Purity | 5mg 10mg Vials | Lyophilized Powder buy - image3
LL37 | US Warehouse | Cosmetic Peptides | 99% Purity | 5mg 10mg Vials | Lyophilized Powder buy - image4
LL37 | US Warehouse | Cosmetic Peptides | 99% Purity | 5mg 10mg Vials | Lyophilized Powder buy - image5
LL37 | US Warehouse | Cosmetic Peptides | 99% Purity | 5mg 10mg Vials | Lyophilized Powder buy - image6

LL37 | US Warehouse | Cosmetic Peptides | 99% Purity | 5mg 10mg Vials | Lyophilized Powder

Unit Price:

$5/G FOB

Get Latest Price
CAS No.:

154947-66-7

Grade:

Pharmaceutical Grade

Content:

99%

Port:

shenzhen

Brand:

Hangzhou Zhongshuan Technology Co., Ltd.

Packaging:

10mg/vial,10vials/box

Price valid (until):

2028-05-28

Company Type:
Trader
Location:
China
Qualification:
Main Products:

peptide

  • Product Description

  • Seller Information

  • Description


      Product Detail  


    Name:Mia

    WeChat and WhatsApp: +86 15354211933

    Email:15354211933@163.com

    We have many peptides,semaglutide tirzepatide,retatrutide,bac water,steriods,MT2,Nad+ ,pills; weight sliming.etc.It can also be customized according to your requirements.Any question pls feel free to contact me at any time.

    Note: Due to policy changes, some products have not been disclosed on here. However, you can still ask us for quotations via email, phone, WhatsApp and WeChat.

    If you couldn't find the product you want in our store, maybe we haven't uploaded the complete product, please feel free to contact us through various ways; if you want to customize and process the product you want, please feel free to contact us for more details too. 

    Shop Semaglutide 2mg 5mg 10mg Powder Peptides Wholesle GLP-1 Sema tirzepatide retatrutize for weight lose-Detailed Image 1

    Shop High quality Bac Water Bacteriostatic Water 10ml 30ml Combined with Peptide tirzepatide cas 7732-18-5-Detailed Image 1

    Shop Factory price top quality CAS 2023788-19-2 Tirzepatide Peptide Weight Loss GLP-1-Detailed Image 1

    Shop Pharmaceutical Product Peptides Cagrilintide Retatrutide Slimming Injection Weight Lose peptide-Detailed Image 4 Shop High quality Bac Water Bacteriostatic Water 10ml 30ml Combined with Peptide tirzepatide cas 7732-18-5-Detailed Image 5

    Items Specifications
    Purity >99%
    Appearance White 
    storage store in cool and dry place
    Origin China

    Product Application

     


    • 1.Helps slow food leaving your stomach
    • 2.Helps prevent your liver from making too much sugar
    • 3.Helps the pancreas produce more insul when your blood sugar levels are high
    • 4.Can help control blood glucose
    • 5.Can reduce hyperglycemia, especially after meals
    • 6.Can reduce fasting insul and fasting glucose
    • 7.Can reduce hemoglobin A1c
    • 8.Can decrease appetite and caloric intake, while inhibiting weight gain
    • 9.Has been shown to lower triglyceride levels and oxidative stress from high LDLShop LL37 | US Warehouse | Cosmetic Peptides | 99% Purity | 5mg 10mg Vials | Lyophilized Powder-Detailed Image 6

    • Company Profile  

       

      Hangzhou Zhongshuan Technology Co., Ltd. is a high-tech company specializing in the research and development and production of IGF-DES. The company has an advanced industrial chain, covering the research and development, approval and industrialization of peptide raw materials and preparations. Its products include innovative drugs, raw materials, enzymes used in medicine and green synthesis industry, functional peptides and protein products.

      Our core strengths are advanced polypeptide technology, strict quality control (conforming to cGMP standards), professional R&D team, and end-to-end solutions from raw materials to finished products.
      We are committed to providing customers with high-quality and high-value products and services and have established a good reputation in the global market. With excellent product quality, logistics service and customer-centered business philosophy, our products have been exported to more than 100 countries.
      Changsha Cao Quan is willing to maintain cooperative relations with old and new friends and create a better future together!

      Shop LL37 | US Warehouse | Cosmetic Peptides | 99% Purity | 5mg 10mg Vials | Lyophilized Powder-Detailed Image 7

       

         Our Advantages  

      Shop LL37 | US Warehouse | Cosmetic Peptides | 99% Purity | 5mg 10mg Vials | Lyophilized Powder-Detailed Image 8


       

         Packaging

       


      Company  takes great care in packaging.We use sturdy materials to protect goods from damage during transit, with tailored packaging for different products. Every item is securely sealed and labeled clearly. Our strict packaging standards ensure items arrive in perfect condition. With a track record of reliable deliveries, we’ve gained clients’trust. You can count on us for safe, professional packaging.

      Shop LL37 | US Warehouse | Cosmetic Peptides | 99% Purity | 5mg 10mg Vials | Lyophilized Powder-Detailed Image 9


       

         How to proceed your order  

       


      Step 1:Please let me know the items you are favorable, quantities, and the destination country.

      Step 2:You confirm all detail, and offer purchasing order.

      Step 3:We send the detail price of our product and offer the suitable shipping method for reference.

      Step 4:You confirm the order and payment 100% in advance and send us the detailed contacting information, including contacting person/company,address,mobile number,ZIP code and your special requirements.

      Step5:We arrange the shipment according to your requirements, and tracking code will be offered once it is released, then you can track your parcel at any moment.

      Step 6:We offer after-sales services after service after you receive your parcel.


      Shop LL37 | US Warehouse | Cosmetic Peptides | 99% Purity | 5mg 10mg Vials | Lyophilized Powder-Detailed Image 10 Shop LL37 | US Warehouse | Cosmetic Peptides | 99% Purity | 5mg 10mg Vials | Lyophilized Powder-Detailed Image 11 Shop LL37 | US Warehouse | Cosmetic Peptides | 99% Purity | 5mg 10mg Vials | Lyophilized Powder-Detailed Image 12

      Transport  

       


      Company offers diverse shipping options: air, land, and sea transport. Orders are shipped within one day of placement, with delivery expected within a week. Boasting a high volume of successful transactions, we’ve earned strong trust from clients. Our efficient logistics ensure timely, reliable delivery, making us a dependable partner for your shipping needs.

      Shop LL37 | US Warehouse | Cosmetic Peptides | 99% Purity | 5mg 10mg Vials | Lyophilized Powder-Detailed Image 13

      Q1. How do you ensure product quality?

      1. We implement a rigorous quality management system, ensuring every batch undergoes comprehensive testing to meet our stringent standards before entering our warehouse.

      2. Our quality assurance team conducts thorough rechecks to validate product quality prior to dispatch.

      3. For absolute certainty, we can dispatch samples to esteemed third-party testing agencies for detailed analysis and verification reports

      . Q2. How can we place an order?

      1. Start by conveying your specific requirements to us.

      2. We will present you with optimal product choices and competitive quotations tailored to your needs.

      3. To confirm product integrity, we provide a comprehensive Certificate of Analysis (COA) and pertinent test spectra or samples.

      4. Upon agreement on quality and pricing, a Proforma Invoice (PI) will be promptly issued.

      5. Proceed by confirming your order, completing the payment, and forwarding the payment slip to us.6. We will meticulously reconfirm all details before shipping and efficiently coordinate the logistics for shipment.

      Q3. Can I have a sample order?

      Yes, welcome to place an sample order to check quality or marke

      Q4. What is your lead time for a new order?

      For stocked items, anticipate a swift delivery within 3-5 business days following payment receipt. For customized orders, we invite a detailed discussion to ensure precision.

      Q5. Do you offer custom services?

      Certainly, we offer bespoke customization services encompassing product specifications, packaging, and exclusive production options to cater to your distinctive needs.

    Basic Info
    Product Name:

    LL-37

    Other Name:

    Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

    CAS No.:

    154947-66-7

    Molecular Formula:

    C205H340N60O53

    InChIKeys:

    POIUWJQBRNEFGX-XAMSXPGMSA-N

    Molecular Weight:

    0

    EC Number:

    211-519-9

    Color/Form:

    White to off-white

    Characteristics
    Water Solubility:

    Soluble to 1 mg/ml in water

  • Seller Information
    Business Type:

    Trader

    Main Products:

    peptide

    Location:

    Room A0693, 6th Floor, Building 3, No.5 Lvtai Road, Zhongtai Subdistrict, Yuhang District, Hangzhou City, Zhejiang Province

    Average lead Time:

    15

    Total Annual Revenue:

    $1 million-$2.5 million

    Total Employees:

    51-100

    Year of Establishment:

    2025

    Hangzhou Zhongbian Technology Co., Ltd. specializes in the R&D and manufacturing of pharmaceutical-grade and healthcare-grade bioactive raw materials and their derivatives, which are widely used in pharmaceuticals, nutraceuticals and cosmetics industries and have gained global recognition for superior bioactivity and safety. Our 100,000-square-meter factory is built in strict compliance with GMP standards, boasting a clean production environment, scientific layout, and complete R&D and manufacturing facilities for deep processing of bioactive raw materials and solvent purification, laying a solid foundation for product quality. We are committed to providing global customers with high-quality products and customized professional solutions, and strive to drive product upgrading across various industries through in-depth cultivation of biotechnology.

    Global Market Reach
    The company's products, with their outstanding quality and stable performance, are exported to over, including the Middle East, South America, North America, Southeast Asia, Africa, Europe, etc., and have accumulated a good reputation in overseas markets. Relying on our professional team and global resource integration capabilities, we fully leverage our geographical and supply chain advantages, continuously optimize localized operations, and effectively help customers reduce costs and improve efficiency while ensuring high-quality products.

    Engaged in Raw Materials for 10+ Years
    We are a biotech enterprise engaged in the R&D, production, and sales of peptides and raw materials for more than 10 years.  The company has complete experimental facilities. Advanced testing instruments ensure the stability of product quality from all aspects. If you're interested in our products, don't hesitate to contact us.

  • Country Product Purchase Quantity Date Posted
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.