Product
Supplier
Encyclopedia
Inquiry
Home > Pharmaceutical Intermediates > Bulk Drug Intermediates > LL-37 for Sale > Good quality LL37 Promote Wound Healing & Tissue Repair factory supply
Good quality LL37 Promote Wound Healing & Tissue Repair factory supply buy - large image1
Good quality LL37 Promote Wound Healing & Tissue Repair factory supply buy - image1
Good quality LL37 Promote Wound Healing & Tissue Repair factory supply buy - image2
Good quality LL37 Promote Wound Healing & Tissue Repair factory supply buy - image3
Good quality LL37 Promote Wound Healing & Tissue Repair factory supply buy - image4
Good quality LL37 Promote Wound Healing & Tissue Repair factory supply buy - image5
Good quality LL37 Promote Wound Healing & Tissue Repair factory supply buy - image6

Good quality LL37 Promote Wound Healing & Tissue Repair factory supply

TDS

Unit Price:

$12-15/MT FOB

Get Latest Price
CAS No.:

154947-66-7

Grade:

Pharmaceutical Grade

Content:

99%

Port:

shenzhen

Brand:

zhongshuan

Packaging:

Vial/Bottle/Bag/Carton

Price valid (until):

2027-01-01

Company Type:
Trader
Location:
China
Qualification:
Main Products:

peptide

  • Product Description

  • Seller Information

  • Description


      Product Detail  


    LL-37 Peptide Full English Introduction

    Basic Information

    • CAS No.: 154947-66-7
    • Full name: LL-37 (human cathelicidin antimicrobial peptide)
    • Source: Cleaved from precursor protein hCAP18, the only cathelicidin peptide naturally produced in human body
    • Composition: 37 amino acids, named after two initial leucine residues (LL) + total 37 amino acids
    • Molecular weight: ~4493 Da
    Items Specifications

    CAS RN

    154947-66-7

    Appearance

    White Powder

    Purity

    99%

    Storage condition

    -20℃

    Core Biological Functions

    1. Broad-spectrum Antimicrobial Effect

    As cationic amphipathic peptide, it binds negatively charged microbial membranes and breaks membrane structure to kill pathogens directly:
    • Gram-positive & Gram-negative bacteria
    • Fungi, enveloped viruses and parasites
    • Penetrate & destroy bacterial biofilms, hard for bacteria to generate drug resistance compared with common antibiotics

    2. Neutralize Endotoxin & Regulate Inflammation

    It binds LPS (bacterial endotoxin) to block TLR2/TLR4 inflammatory signaling, suppress overproduction of inflammatory factors to relieve sepsis and excessive inflammatory response.

    3. Immune Modulation

    • Chemoattract neutrophils, monocytes and T cells to infection sites to boost innate immunity
    • Balance immune activation, mediate communication between innate and adaptive immune system

    4. Promote Wound Healing & Tissue Repair

    • Stimulate migration and proliferation of keratinocytes & fibroblasts to accelerate wound closure
    • Induce angiogenesis (new blood vessel growth) to supply nutrients for damaged skin/mucosa repair
    • Deficiency of LL-37 leads to hard-to-heal chronic ulcers

    5. Additional Research Directions

    • Skin barrier protection, relieve skin inflammatory lesions
    • Anti-tumor research (induce apoptosis of certain tumor cells)
    • Mucosa defense for respiratory, gastrointestinal and urinary tracts
    • Shop Good quality LL37 Promote Wound Healing & Tissue Repair factory supply-Detailed Image 1 Shop Good quality LL37 Promote Wound Healing & Tissue Repair factory supply-Detailed Image 2 Shop Good quality LL37 Promote Wound Healing & Tissue Repair factory supply-Detailed Image 3 Shop Good quality LL37 Promote Wound Healing & Tissue Repair factory supply-Detailed Image 4 Shop Good quality LL37 Promote Wound Healing & Tissue Repair factory supply-Detailed Image 5 Shop Good quality LL37 Promote Wound Healing & Tissue Repair factory supply-Detailed Image 6 Shop Good quality LL37 Promote Wound Healing & Tissue Repair factory supply-Detailed Image 7 Shop Good quality LL37 Promote Wound Healing & Tissue Repair factory supply-Detailed Image 8 Shop Good quality LL37 Promote Wound Healing & Tissue Repair factory supply-Detailed Image 9

    Name Anne 

    whatsapp number  +8618034597101


    PAYMENT METHOD

    Shop Good quality LL37 Promote Wound Healing & Tissue Repair factory supply-Detailed Image 10

    SHIPPING&DELIVERY

    Shop Good quality LL37 Promote Wound Healing & Tissue Repair factory supply-Detailed Image 11

    FAQ

    Q1: About the after-sale service

    A: After purchasing the products from our Lab, we have A professional technical team and after-sales team to serve you and solve all your problems in the future


    Q2: Do you have stock?

    A: We understand most customers prefer stock, so we'll try to keep stock for most products. However, for some rare products, we won't keep stock and it needs time to synthesize.


    Q3: How do I start paying?

    Payment can be made by Bitcoin,wire transfer or paypal


    Q4: How to confirm product quality before placing an order?

    A: We got good feedback from customers and Tested by third-party institutions. You also can get free samples of some products. You just have to pay the shipping fee for the sample .

    You can send us your product specifications and requirements and we can customize for you.


    Q5: What is your MOQ?

    A: The minimum quantity we can order is 1 box.

    But usually we can accept a smaller quantity, say 100g, at the cost of 100% sample charge.


    Q6: Time for delivery?

    A: Leading time within 3 business days,Shipping time about 8-10 business days. 


    Q7: Why should I choose you?

    A: Powerful technical support-come from our highly skilled & fully experienced staff, working in chemical industry for over 5years, in average.Strict quality control-comes form our sophisticated management system.Professional and warm sales team-since we believe we can only win via our hard work in a competitive world.Quick response and excellent presale and after sale service-since we believe our customers deserve all the best service.

    Certificates
    • Good quality LL37 Promote Wound Healing & Tissue Repair factory supply Certificates 1

    Basic Info
    Product Name:

    LL-37

    Other Name:

    Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

    CAS No.:

    154947-66-7

    Molecular Formula:

    C205H340N60O53

    InChIKeys:

    POIUWJQBRNEFGX-XAMSXPGMSA-N

    Molecular Weight:

    0

    EC Number:

    211-519-9

    Color/Form:

    White to off-white

    Characteristics
    Water Solubility:

    Soluble to 1 mg/ml in water

  • Seller Information
    Business Type:

    Trader

    Main Products:

    peptide

    Location:

    Room A0693, 6th Floor, Building 3, No.5 Lvtai Road, Zhongtai Subdistrict, Yuhang District, Hangzhou City, Zhejiang Province

    Average lead Time:

    15

    Total Annual Revenue:

    $1 million-$2.5 million

    Total Employees:

    51-100

    Year of Establishment:

    2025

    Hangzhou Zhongbian Technology Co., Ltd. specializes in the R&D and manufacturing of pharmaceutical-grade and healthcare-grade bioactive raw materials and their derivatives, which are widely used in pharmaceuticals, nutraceuticals and cosmetics industries and have gained global recognition for superior bioactivity and safety. Our 100,000-square-meter factory is built in strict compliance with GMP standards, boasting a clean production environment, scientific layout, and complete R&D and manufacturing facilities for deep processing of bioactive raw materials and solvent purification, laying a solid foundation for product quality. We are committed to providing global customers with high-quality products and customized professional solutions, and strive to drive product upgrading across various industries through in-depth cultivation of biotechnology.

    Global Market Reach
    The company's products, with their outstanding quality and stable performance, are exported to over, including the Middle East, South America, North America, Southeast Asia, Africa, Europe, etc., and have accumulated a good reputation in overseas markets. Relying on our professional team and global resource integration capabilities, we fully leverage our geographical and supply chain advantages, continuously optimize localized operations, and effectively help customers reduce costs and improve efficiency while ensuring high-quality products.

    Engaged in Raw Materials for 10+ Years
    We are a biotech enterprise engaged in the R&D, production, and sales of peptides and raw materials for more than 10 years.  The company has complete experimental facilities. Advanced testing instruments ensure the stability of product quality from all aspects. If you're interested in our products, don't hesitate to contact us.

  • Country Product Purchase Quantity Date Posted
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.