Product
Supplier
Encyclopedia
Inquiry
Home > Pharmaceutical Intermediates > Bulk Drug Intermediates > LL-37 for Sale > IP5 IP10 +99%+peptide+High purity, premium quality, lowest prices, ample supply.
IP5 IP10 +99%+peptide+High purity, premium quality, lowest prices, ample supply. buy - large image1
IP5 IP10 +99%+peptide+High purity, premium quality, lowest prices, ample supply. buy - image1
IP5 IP10 +99%+peptide+High purity, premium quality, lowest prices, ample supply. buy - image2
IP5 IP10 +99%+peptide+High purity, premium quality, lowest prices, ample supply. buy - image3
IP5 IP10 +99%+peptide+High purity, premium quality, lowest prices, ample supply. buy - image4
IP5 IP10 +99%+peptide+High purity, premium quality, lowest prices, ample supply. buy - image5

IP5 IP10 +99%+peptide+High purity, premium quality, lowest prices, ample supply.

1 Inquiries

Unit Price:

$4-5/UNIT FOB

Get Latest Price
CAS No.:

154947-66-7

Grade:

Pharmaceutical Grade

Content:

99%

Port:

shanghai

Brand:

JL

Packaging:

5mg/vial,10vials/box

Price valid (until):

2027-07-02

Company Type:
Trader
Location:
China
Qualification:
Main Products:

Peptide

  • Product Description

  • Seller Information

  • Inquiry History

  • Description


      Product Detail  


    WhatsApp:+852 93524715

    Formula C225H348N48O68 M.Wt 4813.45

    Solubility Soluble in DMSO Storage Store at -20°C

    General tips For obtaining a higher solubility, please warm the tube at 37 ℃ and shake it in the ultrasonic bath for a while.

    Stock solution can be stored below -20℃ for several months.

    Shipping Condition Secure Appearance: Powder Purity: >99% (or refer to the Certificate of Analysis)

    Shipping Condition: Shipped under ambient temperature as non-hazardous chemical. This product is stable enough for a few weeks during ordinary shipping and time spent in Customs.

    Storage Condition: Dry, dark and at 0 - 4 C for short term (days to weeks) or -20 C for long term (months to years).

    Solubility: To be determined Shelf Life: >2 years if stored properly

    Drug Formulation: To be determined

    Stock Solution Storage: 0 - 4 C for short term (days to weeks), or -20 C for long term (months).

    Category Peptides Purpose Weight Loss
    Bottle Color Transparent MOQ 10 Vials
    Purity 99% Storage Dry Cool Sealed Container
    Specification 5mg, 10mg, 15mg, 20mg, 30mg, etc Form Lyophilized Powder(Freeze-Dried Powder)
    Origin China Production Capacity 40000vials/Week

    Shop IP5 IP10 +99%+peptide+High purity, premium quality, lowest prices, ample supply.-Detailed Image 1


      Product Detail  



    Discover a premium-grade solution for modern weight management formulations with our customizable peptide freeze-dried powder, designed for global buyers seeking quality, flexibility, and sustainability. This advanced cosmetic raw material is manufactured under strict quality control standards and presented in sterile plastic vials to ensure purity, stability, and ease of handling throughout transportation and application processes.


    Our peptide powder is available in multiple dosage options—allowing brands, laboratories, and distributors to tailor their product lines according to specific market demands. Whether you are developing innovative cosmetic formulations, research-based solutions, or wellness-oriented product lines, this customizable range provides unmatched versatility. Each vial contains precisely measured, freeze-dried peptide powder that maintains structural integrity and potency, ensuring consistent performance across batches.


    One of the key advantages of this product is its freeze-dried (lyophilized) form, which enhances shelf life and simplifies storage requirements. The process preserves the peptide’s bioactive properties, making it ideal for long-distance shipping and global distribution. The sterile plastic vials are lightweight, durable, and resistant to breakage, offering a safer and more cost-effective alternative to traditional glass packaging. This design also aligns with eco-friendly initiatives by reducing material waste and carbon footprint during logistics.


    Customization is at the core of our offering. We support private labeling, OEM/ODM services, and flexible packaging solutions to help your brand stand out in competitive markets. From logo printing to tailored packaging designs, we enable you to create a unique identity that resonates with your target audience. Our production team works closely with clients to ensure specifications are met with precision, from peptide concentration to packaging aesthetics.


    This peptide raw material is widely used in cosmetic and research applications focused on body contouring, metabolism support, and advanced skincare innovation. Its high purity and reliable quality make it a preferred choice for professionals seeking dependable ingredients for formulation development.


    We prioritize sustainability and global usability. Our eco-conscious packaging and efficient production processes are designed to meet international standards, making this product suitable for export to diverse markets worldwide. Each batch undergoes rigorous testing to ensure compliance with quality benchmarks, providing buyers with confidence and consistency.


    Partner with us to access a reliable supply of high-quality peptide freeze-dried powder, backed by customization options and global logistics support. Whether you are expanding your product portfolio or entering new markets, this versatile and eco-friendly solution is designed to meet your business needs with efficiency and professionalism.

    Shop IP5 IP10 +99%+peptide+High purity, premium quality, lowest prices, ample supply.-Detailed Image 2 Shop IP5 IP10 +99%+peptide+High purity, premium quality, lowest prices, ample supply.-Detailed Image 3
    Shop IP5 IP10 +99%+peptide+High purity, premium quality, lowest prices, ample supply.-Detailed Image 4 Shop IP5 IP10 +99%+peptide+High purity, premium quality, lowest prices, ample supply.-Detailed Image 5


      Company Profile


    Yiwu Jielu Trading Co., Ltd.. Was established in 2019. It mainly deals in peptide products, synthetic peptide amino acids, beauty and slimming products, and beauty freckle removal cosmetic raw materials. It has strong R&D capabilities, superb synthesis technology, and advanced quality control methods. It effectively promotes joint ventures with major companies and manufacturers, and serves the society and users with the concept of industrial development. It always adheres to market demand-oriented, continuously synthesizing new high-tech freckle and wrinkle removal beauty peptide products, which are mainly exported to the United States, Europe, South Africa, Nigeria and other countries and regions. It has rich export experience and ensures transportation safety. 

    Shop IP5 IP10 +99%+peptide+High purity, premium quality, lowest prices, ample supply.-Detailed Image 6 Shop IP5 IP10 +99%+peptide+High purity, premium quality, lowest prices, ample supply.-Detailed Image 7 Shop IP5 IP10 +99%+peptide+High purity, premium quality, lowest prices, ample supply.-Detailed Image 8 Shop IP5 IP10 +99%+peptide+High purity, premium quality, lowest prices, ample supply.-Detailed Image 9 Shop IP5 IP10 +99%+peptide+High purity, premium quality, lowest prices, ample supply.-Detailed Image 10  Shop IP5 IP10 +99%+peptide+High purity, premium quality, lowest prices, ample supply.-Detailed Image 11  Shop IP5 IP10 +99%+peptide+High purity, premium quality, lowest prices, ample supply.-Detailed Image 12 Shop IP5 IP10 +99%+peptide+High purity, premium quality, lowest prices, ample supply.-Detailed Image 13


    Why choose us   


    Superiority

    1.High quality and competitive price.
    2.Free sample for your evaluation.
    3.Promptly delivery by well-reputed shipping lines.
    4.Trial order is available for testing after samples.
    5.We will inform you all the information at every stage in advance.
    6.Packaging can gear to buyers’ special request.

    Our service

    1. Reply your inquiry in 24 working hours.
    2. Customized design is available. OEM are welcomed.
    3. Exclusive and unique solution can be provided to our customer by our well-trained and professional engineers and
    staff.
    4. Professional factory: We are manufacturer, specializing in producing all kinds of herb extract for more than 10 years,

    competitive with good quantity.
    5. As an honest seller, we always use superior raw material, advanced machines, skilled technicians to ensure our products

    to be finished in high quality and stable feature.

    Hazard Identification

    Classification of the substance or mixture

    no data available

    GHS label elements, including precautionary statements

    Pictogram(s) no data available
    Signal word

    no data available

    Hazard statement(s)

    no data available

    Precautionary statement(s)
    Prevention

    no data available

    Response

    no data available

    Storage

    no data available

    Disposal

    no data available

    Other hazards which do not result in classification

    no data available

    Handling and Storage

    Precautions for safe handling

    Handling in a well ventilated place. Wear suitable protective clothing. Avoid contact with skin and eyes. Avoid formation of dust and aerosols. Use non-sparking tools. Prevent fire caused by electrostatic discharge steam.

    Conditions for safe storage, including any incompatibilities

    Store the container tightly closed in a dry, cool and well-ventilated place. Store apart from foodstuff containers or incompatible materials.

    Basic Info
    Product Name:

    LL-37

    Other Name:

    Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

    CAS No.:

    154947-66-7

    Molecular Formula:

    C205H340N60O53

    InChIKeys:

    POIUWJQBRNEFGX-XAMSXPGMSA-N

    Molecular Weight:

    0

    EC Number:

    211-519-9

    Color/Form:

    White to off-white

    Characteristics
    Water Solubility:

    Soluble to 1 mg/ml in water

  • Seller Information
    Business Type:

    Trader

    Main Products:

    Peptide

    Location:

    zhejiangshengjinhuashiyiwushijiangdongjiedaodongnanlu656hao

    Average lead Time:

    15

    Total Annual Revenue:

    $1 million-$2.5 million

    Total Employees:

    5-10

    Year of Establishment:

    2026

    Jielu Trading focuses on the global cross‑border supply chain of high‑end peptide raw materials. Rooted in cutting‑edge biotechnology, we specialize in the selection, quality control, trade and globalized services of peptide products.

    Adhering to strict quality standards and raw material traceability systems, we provide high‑purity and stable peptide raw materials as well as integrated supply‑chain solutions for scientific research, health care and medical aesthetics industries with standardized production and complete compliance qualifications.

    Guided by our brand philosophy With Peptide Power, Integrity Leads Far, Empowering the World, Jielu builds a stable and efficient global trade network with craftsmanship, integrity and global vision. We strive to be an influential benchmark service provider in the worldwide peptide industry, and create a brighter future with global partners.

  • Inquiry History
    1 Inquiries
    Country Product Purchase Quantity Date Posted
    Indonesia

    LL-37

    5 MG Jun 23, 2026
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.