Product
Supplier
Encyclopedia
Inquiry
Home > Pharmaceutical Intermediates > Bulk Drug Intermediates > LL-37 for Sale > Synthetic Organic Biochemical Compound Crystalline Lyophilized Solid For Laboratory In-vitro Research Experiments
Synthetic Organic Biochemical Compound Crystalline Lyophilized Solid For Laboratory In-vitro Research Experiments buy - large image1
Synthetic Organic Biochemical Compound Crystalline Lyophilized Solid For Laboratory In-vitro Research Experiments buy - image1
Synthetic Organic Biochemical Compound Crystalline Lyophilized Solid For Laboratory In-vitro Research Experiments buy - image2
Synthetic Organic Biochemical Compound Crystalline Lyophilized Solid For Laboratory In-vitro Research Experiments buy - image3
Synthetic Organic Biochemical Compound Crystalline Lyophilized Solid For Laboratory In-vitro Research Experiments buy - image4
Synthetic Organic Biochemical Compound Crystalline Lyophilized Solid For Laboratory In-vitro Research Experiments buy - image5
Synthetic Organic Biochemical Compound Crystalline Lyophilized Solid For Laboratory In-vitro Research Experiments buy - image6

Synthetic Organic Biochemical Compound Crystalline Lyophilized Solid For Laboratory In-vitro Research Experiments

TDS 1 Inquiries

Unit Price:

$50/UNIT FOB

Get Latest Price
CAS No.:

154947-66-7

Grade:

Pharmaceutical Grade

Content:

99%

Port:

SHENZHEN

Brand:

ADGN

Packaging:

10ml x 526mg/ml/vial

Price valid (until):

2026-08-16

Company Type:
Trader
Location:
China
Qualification:
Main Products:

Retatrutide,Tirzepatide,Semaglutide,GHK-CU

  • Product Description

  • Seller Information

  • Inquiry History

  • Description
    Items Specifications
    Product Name Synthetic Organic Biochemical Compound Crystalline Lyophilized Solid
    Model No. ORG-016
    Appearance White to off-white crystalline lyophilized powder
    Purity ≥99%
    Storage Condition Sealed low-temperature storage, light-proof, moisture-proof, avoid frequent temperature fluctuation
    Shelf Life 24 months under intact sealed cold storage
    Package Sealed aluminum foil bottle / composite fiber drum

    Important Notice

    This synthetic organic biochemical compound crystalline lyophilized solid is limited to laboratory in-vitro research, chemical qualitative & quantitative analysis and basic biochemical experimental research use only. It shall NOT be adopted as raw materials for pharmaceutical preparation, personal care formulation or any product intended for human body contact. Long-term direct contact with human skin, mucous membranes and eyes must be avoided. Operators must wear gloves, dust-proof eye shields and corresponding protective equipment during all handling operations. Dust inhalation should be strictly prevented.

    Product Introduction

    This product belongs to synthetic organic biochemical compound, appearing as white to off-white crystalline lyophilized powder. After standardized synthesis, separation and purification, the product features stable purity and extremely low content of insoluble impurities. The finished solid maintains stable physical properties under specified storage environment without easy deliquescence or decomposition.

    The product is widely applied in laboratory biochemical exploration, organic chemistry auxiliary research, raw material property testing and a variety of basic experimental projects. We implement unified standardized synthesis and purification procedures to ensure consistent physical and chemical indicators between different production batches.

    We provide diversified packaging schemes and support long-term stable bulk supply. Neutral unlabeled confidential packaging service is available to satisfy procurement demands of scientific research laboratories, chemical research institutions and industrial research enterprises.

    Product Advantages

    1. Adopt multi-step strict purification technology to achieve high purity, effectively guarantee stable experimental repeatability.
    2. Low insoluble impurity content, meeting the testing standards of general laboratory biochemical research experiments.
    3. Flexible packaging specifications, supporting small-volume trial samples and large-scale continuous bulk orders.
    4. Complete batch sampling inspection records; relevant test data can be provided for customers upon formal request.
    5. Adopt standard low-temperature sealed packaging structure, which can effectively isolate air moisture and prevent moisture absorption and deterioration.
    6. Stable solid form, not easy to agglomerate under standard storage conditions, convenient for laboratory weighing and experimental operation.

    Quality Inspection

    Each batch will undergo comprehensive inspection before delivery, including purity testing and appearance observation. All synthesis, purification and packaging steps follow standardized operation flow to reduce human error and stabilize product indicators. Corresponding batch inspection records can be supplied.

    Packaging Information

    Small trial specification: Sealed aluminum foil bottle Bulk specification: Composite fiber drum Outer protection packaging: Shockproof carton with moisture-proof protection Customized label printing service can be supported.

    Storage & Shelf Life

    Keep the container tightly sealed, store under low temperature environment, away from direct sunlight, high humidity and volatile active substances. Avoid frequent temperature fluctuation to prevent solid deterioration. Shelf Life: 24 months under original sealed package and compliant storage environment.

    Shop Synthetic Organic Biochemical Compound Crystalline Lyophilized Solid For Laboratory In-vitro Research Experiments-Detailed Image 1 Shop Synthetic Organic Biochemical Compound Crystalline Lyophilized Solid For Laboratory In-vitro Research Experiments-Detailed Image 2 Shop Synthetic Organic Biochemical Compound Crystalline Lyophilized Solid For Laboratory In-vitro Research Experiments-Detailed Image 3 Shop Synthetic Organic Biochemical Compound Crystalline Lyophilized Solid For Laboratory In-vitro Research Experiments-Detailed Image 4 Shop Synthetic Organic Biochemical Compound Crystalline Lyophilized Solid For Laboratory In-vitro Research Experiments-Detailed Image 5 Shop Synthetic Organic Biochemical Compound Crystalline Lyophilized Solid For Laboratory In-vitro Research Experiments-Detailed Image 6 Shop Synthetic Organic Biochemical Compound Crystalline Lyophilized Solid For Laboratory In-vitro Research Experiments-Detailed Image 7 Shop Synthetic Organic Biochemical Compound Crystalline Lyophilized Solid For Laboratory In-vitro Research Experiments-Detailed Image 8 Shop Synthetic Organic Biochemical Compound Crystalline Lyophilized Solid For Laboratory In-vitro Research Experiments-Detailed Image 9 Shop Synthetic Organic Biochemical Compound Crystalline Lyophilized Solid For Laboratory In-vitro Research Experiments-Detailed Image 10

    Payment and Shipping Methods

    • DHL Global Express

      Door-to-door delivery globally, full cold chain with dry ice, trackable tracking number, smooth customs clearance worldwide.
    • FedEx Global Air Express

      Stable air space, professional customs clearance service, suitable for medium & bulk orders.
    • Local National Postal Lines (Including USPS)

      Cost-effective for 1g-10g small trial samples, final delivery by local post office.
    • Bank T/T Wire Transfer: Formal USD settlement, for bulk orders
    • USDT: USD-pegged stable coin, no exchange loss, widely used in chemical trade
    • Bitcoin BTC: Peer-to-peer on-chain private settlement
    • Shop PT41 Research Grade Synthetic Peptide-Detailed Image 16 Shop PT41 Research Grade Synthetic Peptide-Detailed Image 17 Shop PT41 Research Grade Synthetic Peptide-Detailed Image 18 Shop PT41 Research Grade Synthetic Peptide-Detailed Image 19

    Certificates

    Basic Info
    Product Name:

    LL-37

    Other Name:

    Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

    CAS No.:

    154947-66-7

    Molecular Formula:

    C205H340N60O53

    InChIKeys:

    POIUWJQBRNEFGX-XAMSXPGMSA-N

    Molecular Weight:

    0

    EC Number:

    211-519-9

    Color/Form:

    White to off-white

    Characteristics
    Water Solubility:

    Soluble to 1 mg/ml in water

  • Seller Information
    Business Type:

    Trader

    Main Products:

    Retatrutide,Tirzepatide,Semaglutide,GHK-CU

    Location:

    Plot 1, No. 205 Tongbao Road, Jiangdong Subdistrict, Yiwu City, Jinhua City, Zhejiang Province

    Payment Terms:

    TT against B/L draft before shipment,100% TT in advance

    Year of Establishment:

    2026

  • Inquiry History
    1 Inquiries
    Country Product Purchase Quantity Date Posted
    Indonesia

    LL-37

    5 MG Jun 23, 2026
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.