Product
Supplier
Encyclopedia
Inquiry
Home > Pharmaceutical Intermediates > Bulk Drug Intermediates > LL-37 for Sale > | LL-37 Peptide Raws LL-37 99% Powder Antimicrobial Peptide CAS 154947-66-7 | 5mg.
| LL-37 Peptide Raws LL-37 99% Powder Antimicrobial Peptide CAS 154947-66-7 | 5mg. buy - large image1
| LL-37 Peptide Raws LL-37 99% Powder Antimicrobial Peptide CAS 154947-66-7 | 5mg. buy - image1
| LL-37 Peptide Raws LL-37 99% Powder Antimicrobial Peptide CAS 154947-66-7 | 5mg. buy - image2
| LL-37 Peptide Raws LL-37 99% Powder Antimicrobial Peptide CAS 154947-66-7 | 5mg. buy - image3
| LL-37 Peptide Raws LL-37 99% Powder Antimicrobial Peptide CAS 154947-66-7 | 5mg. buy - image4
| LL-37 Peptide Raws LL-37 99% Powder Antimicrobial Peptide CAS 154947-66-7 | 5mg. buy - image5
| LL-37 Peptide Raws LL-37 99% Powder Antimicrobial Peptide CAS 154947-66-7 | 5mg. buy - image6

| LL-37 Peptide Raws LL-37 99% Powder Antimicrobial Peptide CAS 154947-66-7 | 5mg.

TDS 1 Inquiries

Unit Price:

$100/UNIT FOB

Get Latest Price
CAS No.:

154947-66-7

Grade:

Pharmaceutical Grade

Content:

99%

Port:

Hong Kong

Brand:

customizable

Packaging:

10 bottles per bo

Price valid (until):

2026-08-18

Company Type:
Trader
Location:
China
Qualification:
Main Products:

Tirzepatide,Retatrutide,Survodutide,GHK-CU,GLOW,KLOW

  • Product Description

  • Seller Information

  • Inquiry History

  • Description

                mailbox:shshsjshgs@outlook.com

    whatsapp:+ 852 9354 1384

    What is a peptide? 

    A peptide is a short-chain compound formed by the linkage of multiple amino acids through peptide bonds. It is the basic building block of proteins.
    In simple terms:
    Amino acid = building blocks
    Peptide = several building blocks put together
    Protein = a large structure formed by many building blocks
    Classification of Peptides
    Depending on the number of amino acids:
    Dipeptide: 2 amino acids
    Tripeptide: 3 amino acids
    Oligopeptide: 2 - 20 amino acids
    Polypeptide: more than 20 amino acids
    Protein: usually more than 50 amino acids

    Shop TR Guangdong factory, China Tirzepatide Weight Loss Peptide Powder 2mg 5mg 10mg 15mg 20mg 30mg 100mg-Detailed Image 1 Shop TR Guangdong factory, China Tirzepatide Weight Loss Peptide Powder 2mg 5mg 10mg 15mg 20mg 30mg 100mg-Detailed Image 2 Shop TR Guangdong factory, China Tirzepatide Weight Loss Peptide Powder 2mg 5mg 10mg 15mg 20mg 30mg 100mg-Detailed Image 3 Shop TR Guangdong factory, China Tirzepatide Weight Loss Peptide Powder 2mg 5mg 10mg 15mg 20mg 30mg 100mg-Detailed Image 4

    ems Specifications
    Origin China
    Purity 5%-99%
    Appearance Powder
    Color White
    Package Drum, Plastic container, Vacuum Packed
    Shelf life 2 years
    Storage Cool Dry Place

    What are the functions of peptides?
    There are thousands of peptides naturally present in the human body, which function as "signal transmitters" to regulate bodily functions.
    Common functions include:
    Growth and Repair
    Promote Cell Regeneration
    Tissue Repair
    Collagen Production
    For example:

    GHK-Cu
    BPC-157
    Metabolic regulation
    Control blood sugar
    Regulate appetite
    Promote fat metabolism
    For example:

    Semaglutide
    Tirzepatide
    Retatrutide
    Anti-aging
    Delaying cellular aging
    Promoting DNA repair
    Improving skin condition
    For example:

    Epithalon
    Pinealon
    Cortagen
    Beauty and skincare
    Antioxidation
    Reduce fine lines
    Enhance skin elasticity
    For example:

    GHK-Cu (Blue Copper Peptide) Matrixyl

    Shop TR Guangdong factory, China Tirzepatide Weight Loss Peptide Powder 2mg 5mg 10mg 15mg 20mg 30mg 100mg-Detailed Image 7 Shop TR Guangdong factory, China Tirzepatide Weight Loss Peptide Powder 2mg 5mg 10mg 15mg 20mg 30mg 100mg-Detailed Image 8 Shop Mazdutide 10mg Raw Powder 5mg Factory in Guangdong, China-Detailed Image 7 Shop Mazdutide 10mg Raw Powder 5mg Factory in Guangdong, China-Detailed Image 8 Shop Mazdutide 10mg Raw Powder 5mg Factory in Guangdong, China-Detailed Image 9

    Why are peptides so popular?
    Compared with traditional medications:
    ✅ Highly targeted
    ✅ High biological activity
    ✅ Low dosage
    ✅ Similar to natural substances in the human body
    Therefore, it has been widely studied:
    Weight loss management
    Anti-aging
    Exercise recovery
    Skin care
    Metabolic health
    Scientific research

    Shop Mazdutide 10mg Raw Powder 5mg Factory in Guangdong, China-Detailed Image 10 Shop Mazdutide 10mg Raw Powder 5mg Factory in Guangdong, China-Detailed Image 11


    The actual scene of the workshop


    Shop TR Guangdong factory, China Tirzepatide Weight Loss Peptide Powder 2mg 5mg 10mg 15mg 20mg 30mg 100mg-Detailed Image 9 Shop TR Guangdong factory, China Tirzepatide Weight Loss Peptide Powder 2mg 5mg 10mg 15mg 20mg 30mg 100mg-Detailed Image 10


      company profile  


    Guangzhou Henghuang Trading Co., Ltd. specializes in the field of bioactive peptides, integrating high-end peptide raw material supply, freeze-dried powder production, and customized manufacturing. Based in the Guangdong-Hong Kong-Macao Greater Bay Area, the company is committed to providing premium raw materials and contract manufacturing solutions for the beauty and wellness industries, empowering brand long-term growth through cutting-edge biotechnology.
    The company carefully selects high-quality peptide raw materials, covering a full range of categories including beauty peptides and functional active peptides. The raw materials meet stringent industry standards for purity, ensuring stable molecular activity and suitability for diverse product development needs. Utilizing low-temperature vacuum freeze-drying technology, the lyophilized powder maximizes retention of active ingredients, delivering consistent quality ideal for various applications such as professional skincare, daily care products, and health-related derivatives. By deeply integrating upstream supply chain resources and collaborating with standardized manufacturing facilities, we offer comprehensive services spanning formula development, dosage form preparation, customized specifications, and packaging OEM. This flexible approach accommodates both bulk procurement and niche custom orders, meeting clients' differentiated market strategies.
    The company adheres to strict quality control standards, conducting rigorous inspections at every stage—from raw material intake and sample testing to finished product shipment—ensuring safety and compliance throughout. Guided by the philosophy of craftsmanship for long-term success and mutual growth, it leverages a mature supply chain system and technical service capabilities to balance product quality, delivery efficiency, and cost advantages.
    Focusing on the market, Henghuang Trading maintains a premium positioning by specializing in peptide raw materials and freeze-dried powder products, continuously advancing its product range and manufacturing processes. With reliable supply, flexible customization, and professional technical support, we serve partners worldwide, collaborating closely to deepen our presence in the efficacy-driven market. Together, we are building a high-quality peptide industry ecosystem and establishing ourselves as a trusted provider of raw materials and customized solutions in the sector.

    Shop TR Guangdong factory, China Tirzepatide Weight Loss Peptide Powder 2mg 5mg 10mg 15mg 20mg 30mg 100mg-Detailed Image 11 Shop TR Guangdong factory, China Tirzepatide Weight Loss Peptide Powder 2mg 5mg 10mg 15mg 20mg 30mg 100mg-Detailed Image 12 Shop TR Guangdong factory, China Tirzepatide Weight Loss Peptide Powder 2mg 5mg 10mg 15mg 20mg 30mg 100mg-Detailed Image 13


    Why choose us? 


    1. A complete, stable and high-quality raw material supply chain ensures that customers receive high-quality products.
    2. Strict quality inspection procedures and professional certificate testing guarantee the quality level of the final products.
    3. An excellent sales team can provide customers with integrated and professional services.
    4. We accept various OEM and ODM services to meet the different needs of different customers, with a low minimum order quantity.
    5. Professional suppliers and manufacturers, as well as enterprises integrating production and sales, provide customers with one-stop services. Q&A
    1. Do you accept customization?
    Response: We can provide corresponding customized solutions based on the specific needs of our customers.
    2. Can you provide samples?
    Response: We can offer samples to our customers and send them to them via express delivery promptly.
    3. How is your production capacity? Can you meet the customers' demands in a timely manner? Regarding this, we can produce the products required by the customers on time and have sufficient production capacity.
    4. How long is your delivery cycle?
    For orders under 50 kilograms, they can be dispatched within 5 days. For orders over 50 kilograms, the corresponding time will be negotiated based on the weight of the products.
    5. What are your payment terms?
    Regarding payment: For amounts ≤ $1000, 100% payment is required in advance; for amounts ≥ $1000, 50% payment by wire transfer is required, and the remaining amount should be paid before shipment. Irrevocable sight letter of credit is applicable.
    6. Do you provide OEM or ODM services for products?
    Yes, if needed, we can customize products for you.
    7. How do you ensure that the goods provided meet the standards?
    All goods will be inspected before shipment. If the goods fail to meet our quality commitment, you can apply for a refund.
    8. How will you deliver the goods?
    Regarding: We have close cooperation with DHL, TNT, UPS, FEDEX, EMS, China Air Post. For container products, we can provide shipping services. You can also choose your own freight forwarder.


    type of shipping


    Shop TR Guangdong factory, China Tirzepatide Weight Loss Peptide Powder 2mg 5mg 10mg 15mg 20mg 30mg 100mg-Detailed Image 14 Shop TR Guangdong factory, China Tirzepatide Weight Loss Peptide Powder 2mg 5mg 10mg 15mg 20mg 30mg 100mg-Detailed Image 15

    Certificates
    • | LL-37 Peptide Raws LL-37 99% Powder Antimicrobial Peptide CAS 154947-66-7 | 5mg. Certificates 1

    Basic Info
    Product Name:

    LL-37

    Other Name:

    Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

    CAS No.:

    154947-66-7

    Molecular Formula:

    C205H340N60O53

    InChIKeys:

    POIUWJQBRNEFGX-XAMSXPGMSA-N

    Molecular Weight:

    0

    EC Number:

    211-519-9

    Color/Form:

    White to off-white

    Characteristics
    Water Solubility:

    Soluble to 1 mg/ml in water

  • Seller Information
    Business Type:

    Trader

    Main Products:

    Tirzepatide,Retatrutide,Survodutide,GHK-CU,GLOW,KLOW

    Location:

    Building 1, Floor 2, No. 96 Banhe Road, Huangpu District, Guangzhou City, Room 2164

    Payment Terms:

    TT against copy of documents,D/P,L/C,D/A,O/A,TT against B/L draft before shipment,100% TT in advance

    Average lead Time:

    12

    Total Annual Revenue:

    $1 million-$2.5 million

    Total Employees:

    11-50

    Year of Establishment:

    2026

    Certifications:

    COA,COA,COA,COA,COA

    Company Profile of Guangzhou Henghuang Trading Co., Ltd.
    Guangzhou Henghuang Trading Co., Ltd. specializes in the field of bioactive peptides. It integrates the supply of high-end peptide raw materials, the output of freeze-dried powder products, and personalized customized production. Based in the Guangdong-Hong Kong-Macao Greater Bay Area, it strives to provide high-standard raw materials and OEM solutions for the beauty and health industries, and empowers brand long-term development with cutting-edge biotechnology.
    The company strictly selects high-quality peptide raw materials, covering a full range of categories such as cosmetic peptides and functional active peptides. The purity of the raw materials strictly complies with the advanced industry standards, and the molecular activity is stable, meeting the diverse needs of product development. The freeze-dried powder is processed through a low-temperature vacuum freeze-drying process, which locks the activity of effective substances to the greatest extent. The quality is stable and suitable for various application scenarios such as hospital-line skincare, daily care products, and health derivatives. We deeply integrate upstream supply chain resources and collaborate with standardized production workshops. We can undertake the full chain services of formula development, formulation blending, specification customization, and packaging outsourcing, flexibly matching batch purchases and niche exclusive customization to meet the differentiated layout of customers.
    The enterprise strictly adheres to strict quality control standards, conducting rigorous verification at every step, from raw material entry, sample testing to product delivery. It firmly maintains the quality bottom line of safety and compliance. With the business philosophy of "craftsmanship for the long term, creating win-win outcomes", it relies on a mature supply chain system and technical service capabilities, while also considering product quality, delivery efficiency and cost advantages.
    Focusing on the market, Henghuang Trading adheres to a high-end positioning, deeply delving into the peptide raw materials and freeze-dried powder sectors, and continuously iterating the raw material categories and production processes. With stable supply, flexible customization, and professional technical support, it serves overseas and domestic cooperative merchants, collaborates with partners to deeply explore the efficacy market, builds a high-quality peptide industry ecosystem, and creates a reliable raw material and customization service provider in the industry.

  • Inquiry History
    1 Inquiries
    Country Product Purchase Quantity Date Posted
    Indonesia

    LL-37

    5 MG Jun 23, 2026
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.