Product
Supplier
Encyclopedia
Inquiry
Home > Biochemical Engineering > Polypeptide > LL-37 for Sale > High Quality LL37 CAS 154947-66-7 Safe Delivery
High Quality LL37 CAS 154947-66-7 Safe Delivery buy - large image1
High Quality LL37 CAS 154947-66-7 Safe Delivery buy - image1
High Quality LL37 CAS 154947-66-7 Safe Delivery buy - image2
High Quality LL37 CAS 154947-66-7 Safe Delivery buy - image3
High Quality LL37 CAS 154947-66-7 Safe Delivery buy - image4
High Quality LL37 CAS 154947-66-7 Safe Delivery buy - image5
High Quality LL37 CAS 154947-66-7 Safe Delivery buy - image6

High Quality LL37 CAS 154947-66-7 Safe Delivery

TDS

Unit Price:

$1/G FOB

Get Latest Price
CAS No.:

154947-66-7

Grade:

Pharmaceutical grade

Content:

99%

Port:

CHINA

Brand:

JY

Packaging:

2mg 5mg 10mg Vial

Price valid (until):

2034-03-24

Company Type:
Trader
Location:
Hongkong, China
Qualification:
Main Products:

Peptides

  • Product Description

  • Seller Information

  • Description


    High quality supplier, safe transportationShop Human growth lyophilized-Detailed Image 1


    We are a global professional supplier of pharmaceutical intermediates.
    If you need someone you can trust to provide absolutely pure research chemicals, then work with us and you'll get an absolute guarantee.
    High purity, wholesale price, safe delivery. We have a variety of products, if you want more details, please contact me.
    "High quality products, cost-effective price, stable supply, fast delivery, better reputation, professional service" is our company's business purpose. We sincerely hope to establish stable, strategic and long-term business relationships with domestic and foreign suppliers and customers, and jointly pursue a better future.
    High purity, wholesale price, safe delivery. If you would like more details, please contact me.


    Our advantage

    1. Own your own chemical plant

    2. Rich professional production experience

    3. Sample free and in stock, delivery

    4. Price, quality and service, we care about all your concerns

    5. Timely reply Keep in touch to save your time

    6. Easy customs clearance, we have all these controlsAll very good

    7. Dedicated researchers customize it for you.

    Our guarantee:
    Accurate content and safe transportation. Any accident guaranteed money back! High purity, reliable quality, 100% safety. Lost in the customs inspection process, immediately arrange replacement!

    Shop Semaglutide CAS 910463-68-2 peptide-Detailed Image 2

    Shop Human growth lyophilized-Detailed Image 3

    Appearance: Powder
    Purity: >99% (or reference analysis certificate)
    Transport conditions: Transported as a non-hazardous chemical at ambient temperatures. The product is stable enough for several weeks during normal shipping and customs stay.
    Storage conditions: dry, dark, short term (days to weeks) 0-4 C, long term (months to years) -20 C.
    Solubility: to be determined
    Shelf life: >2 years if stored properly
    Drug formulation: to be determined

    Q&A

    Q1: After-sales service of products

    A: After purchasing products from our factory, we have a professional technical team and after-sales team to serve you and solve all your problems in the future

    Q2: Can I get some samples?

    A: Yes, we can provide samples, but the customer will pay for shipping.

    Q3: How to confirm product quality before placing an order?

    A: You can get free samples of some products. You only need to pay for shipping. You can send us your product specifications and requirements, and we will produce products according to your requirements.

    Q4: What is your minimum order quantity?

    A: The minimum quantity we can order is 1 kg. But usually we can accept a smaller quantity, such as 100 grams, but at the cost of 100% sample fee.

    Q5: Delivery time?

    A: We deliver the goods in 3-7 days with a tracking number. Transit times vary from country to country. Please consult.

    Shop Semaglutide CAS 910463-68-2 peptide-Detailed Image 3

    Certificates
    • High Quality LL37 CAS 154947-66-7 Safe Delivery Certificates 1

    Basic Info
    Product Name:

    LL-37

    Other Name:

    Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

    CAS No.:

    154947-66-7

    Molecular Formula:

    C205H340N60O53

    InChIKeys:

    POIUWJQBRNEFGX-XAMSXPGMSA-N

    Molecular Weight:

    0

    EC Number:

    211-519-9

    Color/Form:

    White to off-white

    Categories:

    Polypeptide

    Characteristics
    Water Solubility:

    Soluble to 1 mg/ml in water

  • Seller Information
    Business Type:

    Trader

    Main Products:

    Peptides

    Location:

    Room 5003, 5th Floor, Yau Lee Centre, 45 Yuen Yuen Road, Kwun Tong, Hong Kong

    Payment Terms:

    TT against copy of documents,D/P,L/C,D/A,O/A,TT against B/L draft before shipment,100% TT in advance

    Total Annual Revenue:

    Less than $1 million

    Total Employees:

    5-10

    Year of Establishment:

    2024

  • Country Product Purchase Quantity Date Posted
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.