Product
Supplier
Encyclopedia
Inquiry
Home > Biochemical Engineering > Polypeptide > LL-37 for Sale > LL37 Powder High Quality Fast Delivery good price 99% Purity
LL37 Powder High Quality Fast Delivery good price 99% Purity buy - large image1
LL37 Powder High Quality Fast Delivery good price 99% Purity buy - image1
LL37 Powder High Quality Fast Delivery good price 99% Purity buy - image2
LL37 Powder High Quality Fast Delivery good price 99% Purity buy - image3
LL37 Powder High Quality Fast Delivery good price 99% Purity buy - image4
LL37 Powder High Quality Fast Delivery good price 99% Purity buy - image5
LL37 Powder High Quality Fast Delivery good price 99% Purity buy - image6

LL37 Powder High Quality Fast Delivery good price 99% Purity

TDS

Unit Price:

$20-25/G FOB

Get Latest Price
CAS No.:

154947-66-7

Grade:

Pharmaceutical Grade

Content:

99%

Port:

GUANGZHOU

Brand:

APKX

Packaging:

5 mg/vial

Price valid (until):

2026-12-24

Company Type:
Trader
Location:
China
Qualification:
Main Products:

peptides

  • Product Description

  • Seller Information

  • Description
    Items Specifications
    Specification 99%
    Packing 5mg/vial;10mg/vial;20mg/vial(10vials/box)
    Shelf life 2 Years

    Benefits:


    1. Ultra-low temperature freezing: Freeze the highly active ingredients at -196 degrees to put the active ingredients into a dormant state.

    2. Effective regeneration: Add the solvent to the powder when using it, and it can be effectively regenerated after mixing, ensuring the high activity and high stability of the product.

    3. Nutrients penetrate deep into the skin: Nano transdermal absorption technology is used to deliver active energy to the deep layers of the skin.


    We offer various types of peptides, and we can provide excellent quality and preferential prices for peptides.

    The feedback from customers who have ordered our products (peptides) is very good.

    Reliable buyers around the world can contact us for peptide matters.


    We believe that Jinbei offers an unparalleled combination of quality, performance and value. If you have any questions about this product or want to learn more about how it can benefit your business, please feel free to contact us. We are committed to providing excellent customer service and helping our customers achieve their business goals.Thank you for considering Jinbei. We look forward to the opportunity to work with you and help you succeed.

    Shop LL37 Powder High Quality Fast Delivery good price 99% Purity-Detailed Image 1

    Shop LL37 Powder High Quality Fast Delivery good price 99% Purity-Detailed Image 2

    Shop LL37 Powder High Quality Fast Delivery good price 99% Purity-Detailed Image 3  Choosing us, you will have a reliable partner, high-quality products, fast and safe transportation, and worry-free after-sales experience. Sincerely hope that we can establish long-term cooperative relations with our customers and achieve a win-win situation.

    Shop LL37 Powder High Quality Fast Delivery good price 99% Purity-Detailed Image 4

    Shop LL37 Powder High Quality Fast Delivery good price 99% Purity-Detailed Image 5

    Shop LL37 Powder High Quality Fast Delivery good price 99% Purity-Detailed Image 6 Shop LL37 Powder High Quality Fast Delivery good price 99% Purity-Detailed Image 7


    Packaging and transportation  


    Shop LL37 Powder High Quality Fast Delivery good price 99% Purity-Detailed Image 8
    Shipping

    By courier
    Suitable for less than 50kg, fast: 3-4 days. High cost; door-to-door delivery. Convenient to pick up.
    FedEx, DHL, EMS, UPS
    By plane
    Suitable for more than 50kg, fast: 4-5 days. High cost: need professional broker from airport to airport
    Sea transport
    Suitable for more than 500kg, slow: 15-45 days low cost. Port to port, you need professional broker.
    Shop LL37 Powder High Quality Fast Delivery good price 99% Purity-Detailed Image 9



      Our advantages


    1. We have our own chemical plant.

    2. We have long-term cooperation with Europe, North America, South America, the Middle East and Asia for export. We have rich professional production experience.

    3. Timely reply to keep in touch and save your time.

    4. Convenient customs clearance, we have these control measures, everything is fine.

    5. Dedicated researchers tailored for you. We can customize and develop a variety of corresponding products according to the special requirements of customers, and provide customers with strong technical support and a whole set of industry solutions.

    6. Price, quality and service, we care about all your concerns. We provide the best private label Jinbei service to meet different customers. Welcome to contact us!

    Shop LL37 Powder High Quality Fast Delivery good price 99% Purity-Detailed Image 10

    Why choose us?

    Professional, Rich Experience.

    1)Rich experience for Europe&North America&South America&Middle East&Asiaexport.

    2)Full experience of large numbers containers loading in Chinese sea port.


    Our Advantages.

    1)All purity>99%.

    2)High quality with competitive price.

    3)We are manufacturer and can provide high quality products with factory price.


    Fast and safe delivery.

    1)Parcel can be sent out in 24 hours after payment tracking number available.

    2)Secure and discreet shipment verious transportation methods for your choice.

    3)Customs pass rate >99%. 


    We have clients throughout the world.

    1)Professional service and rich experience make customers feel at ease, adequate stock and fast delivery meet their different desire.

    2)Market feedback and goods feedback will be appreciated, meeting customers' requirement is our principal responsibility.

    3)High quality, competitive price, fast delivery, first-class service gain the trust and praise from all the customers.


    How to proceed your order:

    Step 1:Please let me know the items you are favorable, quantities, and the destination country.

    Step 2:You confirm all detail, and offer purchasing order.

    Step 3:We send the detail price of our product and offer the suitable shipping method for reference.

    Step 4:You confirm the order and payment 100% in advance and send us the detailed contacting information, including contacting person/company,address,mobile number,ZIP code and your special requirements.

    Step5:We arrange the shipment according to your requirements, and tracking code will be offered once it is released, then you can track your parcel at any moment.

    Step 6:We offer after-sales services after service after you receive your parcel

    Certificates
    • LL37 Powder High Quality Fast Delivery good price 99% Purity Certificates 1

    Basic Info
    Product Name:

    LL-37

    Other Name:

    Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

    CAS No.:

    154947-66-7

    Molecular Formula:

    C205H340N60O53

    InChIKeys:

    POIUWJQBRNEFGX-XAMSXPGMSA-N

    Molecular Weight:

    0

    EC Number:

    211-519-9

    Color/Form:

    White to off-white

    Categories:

    Polypeptide

    Characteristics
    Water Solubility:

    Soluble to 1 mg/ml in water

  • Seller Information
    Business Type:

    Trader

    Main Products:

    peptides

    Location:

    Room 3043, 3rd Floor, Building 15, No. 185 Xinda Road, Wanghailou Street, Hebei District, Tianjin

    Payment Terms:

    TT against copy of documents,D/P,L/C,D/A,O/A,TT against B/L draft before shipment,100% TT in advance

    Average lead Time:

    7

    Total Annual Revenue:

    $10 million-$25 million

    Total Employees:

    11-50

    Year of Establishment:

    2025

    Certifications:

    .,证书


       公司简介  


    Company Profile
    We are a modern, rapidly growing biopharmaceutical company specializing in the production of pharmaceuticals, biologics, and nutraceuticals. We offer internationally leading healthcare products, chemicals, electronics, and mining machinery. Our innovative, full-cycle production facilities fully comply with GMP and ISO standards. We are committed to providing high-quality, affordable, innovative products to prevent disease and support healthier lifestyles. We optimize scientific innovation and production technologies to enable our customers to better serve their consumers. We provide a comprehensive range of services and products for the pharmaceutical and nutraceutical industries, from custom development and production of active ingredients to finished dosage forms. With our scale and resources, we offer our customers one-stop solutions to help people get, feel, and stay well.
    
  • Country Product Purchase Quantity Date Posted
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.