Product
Supplier
Encyclopedia
Inquiry
Home > Cosmetic Ingredient > Emollient > LL-37 for Sale > GHK-CU cosmetic peptides, manufactured by the original factory, with high output and high purity
GHK-CU cosmetic peptides, manufactured by the original factory, with high output and high purity buy - large image1
GHK-CU cosmetic peptides, manufactured by the original factory, with high output and high purity buy - image1
GHK-CU cosmetic peptides, manufactured by the original factory, with high output and high purity buy - image2
GHK-CU cosmetic peptides, manufactured by the original factory, with high output and high purity buy - image3
GHK-CU cosmetic peptides, manufactured by the original factory, with high output and high purity buy - image4
GHK-CU cosmetic peptides, manufactured by the original factory, with high output and high purity buy - image5
GHK-CU cosmetic peptides, manufactured by the original factory, with high output and high purity buy - image6

GHK-CU cosmetic peptides, manufactured by the original factory, with high output and high purity

TDS 1 Inquiries

Unit Price:

$1/G FOB

Get Latest Price
CAS No.:

154947-66-7

Grade:

Pharmaceutical Grade

Content:

99%

Port:

Shenzhen

Brand:

CT

Packaging:

Small bottles, packaged according to customer requirements

Price valid (until):

2026-12-31

Company Type:
Trader
Location:
Hongkong, China
Qualification:
Main Products:

tr

  • Product Description

  • Seller Information

  • Inquiry History

  • Description

     Description 



    WhatsApp:+85292488945

    Product Description


        • Introduction:
        •  
          Copper peptide powder is a compound that combines copper ions with small protein fragments called peptides. It is commonly used in skincareformulations due to its potential benefits for skin health and appearance.

        • Function:
        •  
          1. Improve dynamic wrinkles, relaxing muscles

          2. Anti-carbonylation, Antioxidation, Anti-saccharification, mainly used in cosmetics

          3. Promote rapid wound healing

          4. Widely used as cosmetic additive


    Shop GHK-CU cosmetic peptides, manufactured by the original factory, with high output and high purity-Detailed Image 1

    Does copper peptide regrow hair?

    Copper itself has been reported as being able to help maintain the tissues found in blood vessels. Thus, copper peptides may possibly stimulate hair follicles so they receive adequate oxygen and nutrients to produce new hair growth

    *Can GHK-Cu penetrate the skin?
    *GHK-Cu 

    The permeation rate of GHK-Cu through stratum corneum seems high, the highest of all three skin strata studied. It seems consistent with a model of porous transport, as appendageal penetration is considered to be one, if not the predominant pathway for the diffusion of multipolar ions.
    Shop GHK-CU cosmetic peptides, manufactured by the original factory, with high output and high purity-Detailed Image 2
    Items Specifications

    Product Name

    Ghk-Cu Copper Peptide
    Form Solid  powder
    Storage condition -20°C
    Shop GHK-CU cosmetic peptides, manufactured by the original factory, with high output and high purity-Detailed Image 3


    Main peptides  


    The company's main peptide products, a variety of products, covering beauty peptides, weight loss peptides and tanning peptides and other fields. We are committed to translating the latest scientific research results into highly effective and safe peptide products that meet the diverse needs of our customers.

     Beauty peptide  


    Beauty peptide is one of our special products, with its efficient and safe chara cteristics, favored by the majority of consumers. Beauty peptides can promote the production of skin collagen, improve skin elasticity, reduce wrinkles and fine lines, and make skin smoother and more delicate. In addition, beauty peptides also have antioxidant, anti-inflammatory and other effects, which can effectively fight against the damage of the external environment to the skin and delay the aging process.

     Weight loss peptides


    Slimming peptide is an important product for modern people to pursue health and beauty. The weight loss peptides we developed can help consumers achieve healthy weight loss by regulating the body's metabolism, suppressing appetite, accelerating fat decomposition and other ways. Weight loss peptides can not only effectively reduce body fat, but also maintain muscle mass and avoid problems such as skin sagging during weight loss.

    Tanning polypeptide


    Tanning peptides are products that promote the production of melanin in the skin, helping consumers achieve a healthy, natural tan. Tanning peptide by stimulating the activity of skin melanocytes, make the skin gradually dark, but also has a certain sunscreen effect, reduce the damage of ultraviolet light to the skin. Our tanning peptides are easy to use and effective, making them the ideal choice for consumers looking for a tan.

    Shop GHK-CU cosmetic peptides, manufactured by the original factory, with high output and high purity-Detailed Image 4
    Shop GHK-CU cosmetic peptides, manufactured by the original factory, with high output and high purity-Detailed Image 5


    Function

     
    1. GHK-Cu can accelerate wound repair;

    2. GHK-Cu can increase skin re-epithelialization;

    3. GHK-Cu can reverse aging effects on skin;

    4. GHK-Cu can thicken skin, improve elasticity, and increase subcutaneous fat layer;

    5. GHK-Cu can improve hair transplant success ,prevent hair loss;

    6. GHK-Cu analogs with fatty residue analogs increase hair follicle size, stimulate hair growth and reduce hair loss. 


    Shop GHK-CU cosmetic peptides, manufactured by the original factory, with high output and high purity-Detailed Image 6
     

     Our service  

     


    1. We supply Peptides, APIs & Intermediates and so on to satisfy your needs; 

    2. We will reply you for your inquiry in 24 hours; 

    3.  Strictly on selecting raw materials .  Our Q&C team will inspect every product quality strictly before delivery;

    4. Reasonable & competitive price, fast lead time 

    5. After delivery, we will track the products for you once every two days, until you get the products. When you got the goods, if you have any questions about the problem, contact with us, we will offer the solve way for you 

    6. 100% safe delivery, guaranteed delivery .

    Shop GHK-CU cosmetic peptides, manufactured by the original factory, with high output and high purity-Detailed Image 7
    Shop GHK-CU cosmetic peptides, manufactured by the original factory, with high output and high purity-Detailed Image 8
    • The importance of peptides:


    • Many active substances in the human body are in the form of peptides. Peptides are involved in various fields of human hormones, nerves, cell growth and reproduction, and their importance is to regulate the physiological functions of various systems and cells in the body, activate the relevant enzyme systems in the body, promote the permeability of intermediate metabolic membranes, or control DNA transcription or affect specific protein synthesis, and ultimately produce specific physiological effects. Peptides are important substances involved in various cell functions in human body. Peptides can be synthesized into cells and regulate their functional activities. Peptides act as neurotransmitters in the body, transmitting information.

    Shop GHK-CU cosmetic peptides, manufactured by the original factory, with high output and high purity-Detailed Image 9

     Why choose us?  


      

     

    1. High quality standards: All ingredients are tested for purity and performance.


    2. Competitive prices: We offer exceptional value without compromising quality.

    3. Customization: Solutions tailored to your specific needs and formulations.

    4. Reliable delivery: Timely and efficient transportation to ensure that your production schedule is met.

    Shop GHK-CU cosmetic peptides, manufactured by the original factory, with high output and high purity-Detailed Image 10
    Shop GHK-CU cosmetic peptides, manufactured by the original factory, with high output and high purity-Detailed Image 11

     Company Profile


     

     Our company is a modern advanced enterprise specializing in production and exportation of APIs, Pharmaceutical intermediates, plant extracts etc. Our products are widely used in medicine, health care products, cosmetics, nutritional supplements and food additives areas. Our factory covers an area of 95 acres, the proposed construction of the plant will be GMP standards, the factory environment clean and tidy, rational layout, with large and medium-sized production workshop and repocessed shop. It is equipped with advanced equipment quality inspection and research center. Those products of both quality and technical content have reached the domestic advanced level. Since its establishment, the company has attached great importance to the team training and technical reform. Our modern production equipment guarantees for a fast and effective production with a superior degree of accuracy throughout the whole production line, everything is done in-house, processing, extraction, packaging and transportation of all links, ensuring maximum quality and efficiency. We are constantly research and development new ingredients and innovative new products, have earned the respect & Admiration from the worldwide customers. After years of continuous development, company has been accumulated rich experience in international trade and customer resources, established a stable customer base and perfect marketing service network. In addition, the company has established long-term technical cooperation with experts and professors from many universities and research institutes in the province.

      Our company is committed to the development, production and sales of polypeptide products, and enjoys a high reputation in the industry with excellent sales ability. The company has an experienced and professional sales team, who not only have deep product knowledge, but also can provide tailor-made solutions according to customer needs. We actively expand domestic and foreign markets, has established a stable sales network in many countries and regions.

    Adhering to the concept of "customer first", the sales team always pays attention to the market dynamics and customer feedback, and timely adjusts the sales strategy to ensure that customers get the most satisfactory service and products. At the same time, we use advanced CRM customer relationship management system to scientifically manage customer information and order process to ensure that every order can be efficiently and accurately executed from receipt to delivery.




    Quality assurance


    The company always adheres to the principle of "quality first" and conducts production management in strict accordance with international standards and industry norms. We have modern production equipment and first-class laboratories, all products must pass strict quality testing before leaving the factory to ensure that they meet the highest purity and quality requirements. Our quality management system is ISO9001 certified, ensuring that each batch of products meets international standards.

    In order to ensure the stability and safety of products, we implement strict quality control in every link from raw material procurement to production and processing. All raw materials are sourced from certified suppliers and subjected to rigorous testing and screening. The production process is operated in strict accordance with GMP (Good Manufacturing Practice for Drugs) to ensure the high purity and efficiency of the product

    Shop GHK-CU cosmetic peptides, manufactured by the original factory, with high output and high purity-Detailed Image 12
    Shop GHK-CU cosmetic peptides, manufactured by the original factory, with high output and high purity-Detailed Image 13

    Certificates
    • GHK-CU cosmetic peptides, manufactured by the original factory, with high output and high purity Certificates 1

    Basic Info
    Product Name:

    LL-37

    Other Name:

    Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

    CAS No.:

    154947-66-7

    Molecular Formula:

    C205H340N60O53

    InChIKeys:

    POIUWJQBRNEFGX-XAMSXPGMSA-N

    Molecular Weight:

    0

    EC Number:

    211-519-9

    Color/Form:

    White to off-white

    Categories:

    Emollient

    Characteristics
    Water Solubility:

    Soluble to 1 mg/ml in water

  • Seller Information
    Business Type:

    Trader

    Main Products:

    tr

    Location:

    B27 SHING LEE COMM BLDG 8WING KUT ST CENTRAL HONGKONG

    Average lead Time:

    1

    Total Annual Revenue:

    Less than $1 million

    Total Employees:

    5-10

    Year of Establishment:

    2026

    20 years of production experience in peptide products

    Safe and unobstructed shipping channels|High quality guaranteed|

    Our company is located in Guangzhou, China. Its production facilities are situated in a modern 5,000-square-meter factory. As a private enterprise, we have over 200 professional employees and are actively expanding our team to support future growth. Over the past two decades, as a comprehensive enterprise integrating research, production, processing and export in the chemical industry, we have performed exceptionally well. Since our establishment, we have always adhered to the principles of "honest management, strict quality control, and customer-oriented service", and have received continuous praise from global customers. Our company is a Chinese manufacturer of peptide products, guaranteeing product quality and effectiveness at affordable prices. We offer reliable and secure shipping channels with discreet delivery to ensure safe and timely arrival.


  • Inquiry History
    1 Inquiries
    Country Product Purchase Quantity Date Posted
    Indonesia

    LL-37

    5 MG Jun 23, 2026
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.