Product
Supplier
Encyclopedia
Inquiry
Home > Cosmetic Ingredient > Abrasive > LL-37 for Sale > TB500 Thymosin B4 Acetate BT5 BT10 Safe delivery of personalized peptides High purity
TB500 Thymosin B4 Acetate BT5 BT10 Safe delivery of personalized peptides High purity buy - large image1
TB500 Thymosin B4 Acetate BT5 BT10 Safe delivery of personalized peptides High purity buy - image1
TB500 Thymosin B4 Acetate BT5 BT10 Safe delivery of personalized peptides High purity buy - image2
TB500 Thymosin B4 Acetate BT5 BT10 Safe delivery of personalized peptides High purity buy - image3
TB500 Thymosin B4 Acetate BT5 BT10 Safe delivery of personalized peptides High purity buy - image4
TB500 Thymosin B4 Acetate BT5 BT10 Safe delivery of personalized peptides High purity buy - image5
TB500 Thymosin B4 Acetate BT5 BT10 Safe delivery of personalized peptides High purity buy - image6

TB500 Thymosin B4 Acetate BT5 BT10 Safe delivery of personalized peptides High purity

TDS

Unit Price:

$1/G FOB

Get Latest Price
CAS No.:

154947-66-7

Grade:

Pharmaceutical Grade

Content:

99%

Port:

shenzhen

Brand:

sc

Packaging:

5 milligrams /10 milligrams. 10 bottles per box

Price valid (until):

2027-03-31

Company Type:
Trader
Location:
Hongkong, China
Qualification:
Main Products:

tr

  • Product Description

  • Seller Information

  • Description


      Product Detail   


    Sales manager: Sofia

    WhatsApp:+85293652837

    Appearance: Powder

    Purity: >99% (or refer to the Certificate of Analysis)

    Shipping Condition: Shipped under ambient temperature as non-hazardous chemical. This product is stable enough for a few weeks during ordinary shipping and time spent in Customs.

    Storage Condition: Dry, dark and at 0 - 4 C for short term (days to weeks) or -20 C for long term (months to years).

    Solubility: To be determined

    Shelf Life: >2 years if stored properly

    Drug Formulation: To be determined

    Stock Solution Storage: 0 - 4 C for short term (days to weeks), or -20 C for long term (months).

    Shop TB500 Thymosin B4 Acetate BT5 BT10 Safe delivery of personalized peptides High purity-Detailed Image 1

    ——      FAQ     ——

    Q1.Can I have a sample order?

    A: Yes, welcome to place an sample order to check quality or market.

    Q2.What's the sample and goodslead time?

    A:The stock sample for l day,custom sample for 7-10 days,bulk order for 20-25 days.

    Q3.Do you have any MOQ limit?

    A:yes,the MOQ is 100pcs but any trial order is welcome.

    Q4.How do you ship the goods and how long does it take to arrive?

    A:According to your order quantity,usually ship by sea or by air and by express,20-30 days by sea,5-7 days by air and 3-5 days byexpress.

    Q5.How to proceed an order?

    A: Firstly let us know your requirements. Secondly We quote according to your requirements or our suggestions. Thirdly customer confirm the artworks and pay deposit for formal order.Fourthly We arrange the production & shipment then you pay balance to us.

    Q6.Is it OK to print my logo on the product?

    A: Yes.Please provide the logo Al file so that our designer can make the mock up for you approval.

    Q7: Can you support custom packing?

    A: Sure,custom poly bag with warning text,gift box or display box is welcomes.

    Shop TB500 Thymosin B4 Acetate BT5 BT10 Safe delivery of personalized peptides High purity-Detailed Image 2

    ——      Why Choose Us    ——

    •High quality products: We have rich experience in production and processing, strict quality inspection.

    •Reasonable prices: Factory direct, reasonable price and negotiable.

    •Processing customization: OEM/ODM is acceptable, at the same time, we support the customization of product specifications

    •Quick response: We will reply to your message within 24 hours.

    •Good after-sales service: we have a professional team to solve the problems you encounter in the process of using the products.

    Shop TB500 Thymosin B4 Acetate BT5 BT10 Safe delivery of personalized peptides High purity-Detailed Image 3

    We have many years of trading experience and are professional Chemical raw materials, medicine, Pharmaceutical raw material suppliers in overseas . Hope to cooperate with you for a long time and achieve win-win purpose. Our experienced staff is committed to strict quality control and attentive customer service and is always available to discuss your requirements and ensure complete customer satisfaction. Our company firmly believes that all products must comply with international quality standards. We therefore focus on sourcing quality materials and ensuring strict internal process controls. Our professional inspectors ensure that the products delivered to our customers are perfect. Our company adhere to the "customer first, reputation assurance, quality assurance, professional service" policy. No matter what type of product you need, you can contact us at any time, we will provide high quality products in the fastest and best way to achieve customer satisfaction. In addition, we will provide the best service to our customers. We look forward to establishing long-term business relations with overseas on the basis of mutual benefit in the near future. If you are interested in our products or companies, please feel free to contact us for more details!

    Shop TB500 Thymosin B4 Acetate BT5 BT10 Safe delivery of personalized peptides High purity-Detailed Image 4

    ——      Our advantage    ——

    Safe, effective and efficient customer service. Our products are produced quickly and safely. Provide samples before regular order. We focus on serving foreign customers, our products sell well in many countries. We ensure quality products and reasonable prices. We have good after-sales service, solve any type of problem, the goal is to make every customer satisfied with our company and get the best reputation.

    Shop TB500 Thymosin B4 Acetate BT5 BT10 Safe delivery of personalized peptides High purity-Detailed Image 5 Shop TB500 Thymosin B4 Acetate BT5 BT10 Safe delivery of personalized peptides High purity-Detailed Image 6 Shop TB500 Thymosin B4 Acetate BT5 BT10 Safe delivery of personalized peptides High purity-Detailed Image 7

    ——       Our factory      ——

    Shop TB500 Thymosin B4 Acetate BT5 BT10 Safe delivery of personalized peptides High purity-Detailed Image 8 Shop TB500 Thymosin B4 Acetate BT5 BT10 Safe delivery of personalized peptides High purity-Detailed Image 9

    ——      Packing & Delivery     ——Shop TB500 Thymosin B4 Acetate BT5 BT10 Safe delivery of personalized peptides High purity-Detailed Image 10 Shop TB500 Thymosin B4 Acetate BT5 BT10 Safe delivery of personalized peptides High purity-Detailed Image 11

    Certificates
    • TB500 Thymosin B4 Acetate BT5 BT10 Safe delivery of personalized peptides High purity Certificates 1

    Basic Info
    Product Name:

    LL-37

    Other Name:

    Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

    CAS No.:

    154947-66-7

    Molecular Formula:

    C205H340N60O53

    InChIKeys:

    POIUWJQBRNEFGX-XAMSXPGMSA-N

    Molecular Weight:

    0

    EC Number:

    211-519-9

    Color/Form:

    White to off-white

    Categories:

    Abrasive

    Characteristics
    Water Solubility:

    Soluble to 1 mg/ml in water

  • Seller Information
    Business Type:

    Trader

    Main Products:

    tr

    Location:

    B27 SHING LEE COMM BLDG 8WING KUT ST CENTRAL HONGKONG

    Total Annual Revenue:

    Less than $1 million

    Total Employees:

    5-10

    Year of Establishment:

    2026

  • Country Product Purchase Quantity Date Posted
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.