Product
Supplier
Encyclopedia
Inquiry
Home > Cosmetic Ingredient > Abrasive > LL-37 for Sale > hyaluronic acid-5mg *1 vials PNC 27 Pinealon HA5 PNC 27 PNC 27 PI5 PI10 P20 Mazdutide Survodutide MZ SUR10 China factory peptides
hyaluronic acid-5mg *1 vials PNC 27  Pinealon HA5 PNC 27 PNC 27 PI5 PI10 P20 Mazdutide Survodutide MZ SUR10 China factory peptides buy - large image1
hyaluronic acid-5mg *1 vials PNC 27  Pinealon HA5 PNC 27 PNC 27 PI5 PI10 P20 Mazdutide Survodutide MZ SUR10 China factory peptides buy - image1
hyaluronic acid-5mg *1 vials PNC 27  Pinealon HA5 PNC 27 PNC 27 PI5 PI10 P20 Mazdutide Survodutide MZ SUR10 China factory peptides buy - image2
hyaluronic acid-5mg *1 vials PNC 27  Pinealon HA5 PNC 27 PNC 27 PI5 PI10 P20 Mazdutide Survodutide MZ SUR10 China factory peptides buy - image3
hyaluronic acid-5mg *1 vials PNC 27  Pinealon HA5 PNC 27 PNC 27 PI5 PI10 P20 Mazdutide Survodutide MZ SUR10 China factory peptides buy - image4
hyaluronic acid-5mg *1 vials PNC 27  Pinealon HA5 PNC 27 PNC 27 PI5 PI10 P20 Mazdutide Survodutide MZ SUR10 China factory peptides buy - image5
hyaluronic acid-5mg *1 vials PNC 27  Pinealon HA5 PNC 27 PNC 27 PI5 PI10 P20 Mazdutide Survodutide MZ SUR10 China factory peptides buy - image6

hyaluronic acid-5mg *1 vials PNC 27 Pinealon HA5 PNC 27 PNC 27 PI5 PI10 P20 Mazdutide Survodutide MZ SUR10 China factory peptides

TDS

Unit Price:

$1/G FOB

Get Latest Price
CAS No.:

154947-66-7

Grade:

Pharmaceutical Grade

Content:

99%

Port:

shenzhen

Brand:

sc

Packaging:

5mg/ 10mg / 20mg. 10 bottles per box

Price valid (until):

2027-10-31

Company Type:
Trader
Location:
Hongkong, China
Qualification:
Main Products:

tr

  • Product Description

  • Seller Information

  • Description

    Sales manager: Sofia

    WhatsApp:+85244569741

    Sincerely look forward to your inquiries about our products.


    ——      Product Detail      ——

    Our products are widely used in life science research, drug discovery, cosmetics, anti-aging medicine, and functional health industries.

    1. Superior Product Quality

    Product quality is the foundation of our business. Peptides are synthesized using solid-phase peptide synthesis (SPPS), then purified through HPLC and confirmed by mass spectrometry (MS).

    Each batch includes a Certificate of Analysis (COA) with key data:
    • Purity (HPLC)
    • Molecular weight (MS)
    • Water content
    • Residual solvents
    • Microbial limit (if applicable)

    For clients with higher regulatory demands, we also provide third-party testing reports, endotoxin (LAL) data, and stability studies upon request.

    2. Customization & R&D Support

    We offer flexible custom synthesis services, supported by an experienced R&D team. Whether you’re looking for novel peptide sequences, cosmetic-grade purity, or modified molecules (e.g., PEGylation, acetylation), we can deliver high-quality results on time.

    Our services include:
    • Custom peptide synthesis (mg to kg scale)
    • Peptide modifications and labeling
    • Small molecule synthesis
    • Project-based research and scale-up

    We work closely with our clients to ensure technical feasibility, fast delivery, and cost control throughout the development cycle.

    3. Wide Product Portfolio

    We supply a comprehensive and expanding product range:
    • Peptides: GLP-1 analogs (e.g., Semaglutide, Tirzepatide, Retatrutide), cosmetic peptides (e.g., Acetyl Hexapeptide-8, Matrixyl), anti-aging peptides, research peptides.
    • Small Molecules: Nootropics, NAD+ boosters (e.g., NMN, NR, NADH), and intermediates.
    • Biochemicals: Amino acid derivatives, enzyme co-factors, custom reagents.

    New products are launched regularly to meet evolving market needs. We also support batch reservations for clients with ongoing or seasonal demand.

    Shop Pinealon PI5 PI10 P20 Mazdutide Survodutide MZ SUR10 Quality guarantee factory outlet-Detailed Image 2

    Shop hyaluronic acid-5mg *1 vials PNC 27  Pinealon HA5 PNC 27 PNC 27 PI5 PI10 P20 Mazdutide Survodutide MZ SUR10 China factory peptides-Detailed Image 2

    ——        FAQ        ——

    Question 1: How is the product after-sales service?

    A: We provide comprehensive after-sales support for all factory-produced products. We have a professional technical and after-sales team who are always ready to solve any problems you encounter during the subsequent use, ensuring your rights.

    Question 2: Can samples be provided?

    A: Of course. We are more than happy to provide samples. The samples are free of charge, but the related transportation costs need to be borne by you.

    Question 3: What payment methods are available? How do I start the payment?

    A: We support multiple payment methods.You can choose the most convenient method to complete the payment.

    Question 4: How can I confirm the product quality before placing an order?

    A: We fully understand your concern about the quality. You can apply for a free sample for testing (you only need to pay for the shipping cost). Additionally, you can provide us with detailed product specifications and specific requirements, and we will produce and control the quality strictly according to your standards.

    Question 5: How long is the delivery time?

    A: We promise to arrange the shipment within 3 to 7 days after receiving the order, and will promptly provide the tracking number. The specific delivery time may vary depending on the logistics situation in your country or region. We recommend that you consult our customer service staff for a more accurate estimated time.

    Shop hyaluronic acid-5mg *1 vials PNC 27  Pinealon HA5 PNC 27 PNC 27 PI5 PI10 P20 Mazdutide Survodutide MZ SUR10 China factory peptides-Detailed Image 3

    ——      Why Choose Us      ——

    1. We supply Peptides, APIs & Intermediates and so on to satisfy your needs;
    2. We will reply you for your inquiry in 24 hours;
    3. Strictly on selecting raw materials . Our Q&C team will inspect every product quality strictly before delivery;

    4. Reasonable & competitive price, fast lead time ;

    5. After delivery, we will track the products for you once every two days, until you get the products. When you got the goods, if you have any questions about the problem, contact with us, we will offer the solve way for you ;

    6. 100% safe delivery, guaranteed delivery.

    Shop hyaluronic acid-5mg *1 vials PNC 27  Pinealon HA5 PNC 27 PNC 27 PI5 PI10 P20 Mazdutide Survodutide MZ SUR10 China factory peptides-Detailed Image 4

    ——      Our advantage    ——

    At the core of our operations is the unwavering commitment to our guiding principles : "Quality First, Service Supreme."Our mission is to spearhead advancements in biotechnology by consistently upholding the highest standards of quality and service. Through innovation and excellence, we aim to contribute to the betterment of global health and well-being.

    Our primary focus encompasses a range of products , including weight loss peptides, cosmetic peptides, and customized peptides. Notable among our weight loss peptide offerings are Tirzepatide, Retatrutide, and others.Provides reliable and timely custom manufacturing services for API following stringent quality system and close communication with the Clients.We have professional sales team , focus on quality and service, and we have achieved excellent performance over the years. Our company is committed to the development of international market, our products are mainly exported to many countries and regions, such as Europe, America, South-east Asia, the Middle East and Africa etc.

    With our constant efforts and good service, We sincerely hope to establish long-term cooperation and common development with our customers .

    Shop hyaluronic acid-5mg *1 vials PNC 27  Pinealon HA5 PNC 27 PNC 27 PI5 PI10 P20 Mazdutide Survodutide MZ SUR10 China factory peptides-Detailed Image 5

    ——      Storage Conditions     ——

    Should be stored in the refrigerator at 2°C to 8°C, away from light.

    If required, each single-dose pen can be stored unrefrigerated at a temperature not exceeding 30°C for up to 21 days, but once stored at room temperature it should not be returned to the refrigerator. If not used within 21 days after removal from the refrigerator, it should be discarded. Do not freeze tilpotide and if frozen, do not use.

    Shop hyaluronic acid-5mg *1 vials PNC 27  Pinealon HA5 PNC 27 PNC 27 PI5 PI10 P20 Mazdutide Survodutide MZ SUR10 China factory peptides-Detailed Image 6 Shop hyaluronic acid-5mg *1 vials PNC 27  Pinealon HA5 PNC 27 PNC 27 PI5 PI10 P20 Mazdutide Survodutide MZ SUR10 China factory peptides-Detailed Image 7

    ——       Our factory      ——

    Shop hyaluronic acid-5mg *1 vials PNC 27  Pinealon HA5 PNC 27 PNC 27 PI5 PI10 P20 Mazdutide Survodutide MZ SUR10 China factory peptides-Detailed Image 8

    Shop hyaluronic acid-5mg *1 vials PNC 27  Pinealon HA5 PNC 27 PNC 27 PI5 PI10 P20 Mazdutide Survodutide MZ SUR10 China factory peptides-Detailed Image 9 Shop hyaluronic acid-5mg *1 vials PNC 27  Pinealon HA5 PNC 27 PNC 27 PI5 PI10 P20 Mazdutide Survodutide MZ SUR10 China factory peptides-Detailed Image 10

    ——        Customer Feedback       ——

    Shop hyaluronic acid-5mg *1 vials PNC 27  Pinealon HA5 PNC 27 PNC 27 PI5 PI10 P20 Mazdutide Survodutide MZ SUR10 China factory peptides-Detailed Image 11 Shop hyaluronic acid-5mg *1 vials PNC 27  Pinealon HA5 PNC 27 PNC 27 PI5 PI10 P20 Mazdutide Survodutide MZ SUR10 China factory peptides-Detailed Image 12

    ——      Packing & Delivery     ——

    Shop hyaluronic acid-5mg *1 vials PNC 27  Pinealon HA5 PNC 27 PNC 27 PI5 PI10 P20 Mazdutide Survodutide MZ SUR10 China factory peptides-Detailed Image 13 Shop hyaluronic acid-5mg *1 vials PNC 27  Pinealon HA5 PNC 27 PNC 27 PI5 PI10 P20 Mazdutide Survodutide MZ SUR10 China factory peptides-Detailed Image 14 Shop hyaluronic acid-5mg *1 vials PNC 27  Pinealon HA5 PNC 27 PNC 27 PI5 PI10 P20 Mazdutide Survodutide MZ SUR10 China factory peptides-Detailed Image 15

    Welcome to be our distinguished customer, please do not hesitate to contact us!

    Certificates
    • hyaluronic acid-5mg *1 vials PNC 27  Pinealon HA5 PNC 27 PNC 27 PI5 PI10 P20 Mazdutide Survodutide MZ SUR10 China factory peptides Certificates 1

    Basic Info
    Product Name:

    LL-37

    Other Name:

    Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

    CAS No.:

    154947-66-7

    Molecular Formula:

    C205H340N60O53

    InChIKeys:

    POIUWJQBRNEFGX-XAMSXPGMSA-N

    Molecular Weight:

    0

    EC Number:

    211-519-9

    Color/Form:

    White to off-white

    Categories:

    Abrasive

    Characteristics
    Water Solubility:

    Soluble to 1 mg/ml in water

  • Seller Information
    Business Type:

    Trader

    Main Products:

    tr

    Location:

    B27 SHING LEE COMM BLDG 8WING KUT ST CENTRAL HONGKONG

    Total Annual Revenue:

    Less than $1 million

    Total Employees:

    5-10

    Year of Establishment:

    2026

  • Country Product Purchase Quantity Date Posted
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.