Product
Supplier
Encyclopedia
Inquiry
LL-37 154947-66-7 buy - large image1
LL-37 154947-66-7 buy - image1
LL-37 154947-66-7 buy - image2
LL-37 154947-66-7 buy - image3
LL-37 154947-66-7 buy - image4
LL-37 154947-66-7 buy - image5
LL-37 154947-66-7 buy - image6

LL-37 154947-66-7

1 Inquiries

Unit Price:

$7-8/MT FOB

Get Latest Price
CAS No.:

154947-66-7

Grade:

Food grade

Content:

99%

Port:

shenzhen

Brand:

Flying

Packaging:

10g/1kg/ 10kg/ 25kg

Price valid (until):

2026-07-23

Company Type:
Trader
Location:
China
Qualification:
Main Products:

vitamin

  • Product Description

  • Seller Information

  • Inquiry History

  • Description


      Product Detail  


    Superiority

    1.High quality and competitive price.
    2.Free sample for your evaluation.
    3.Promptly delivery by well-reputed shipping lines.
    4.Trial order is available for testing after samples.
    5.We will inform you all the information at every stage in advance.
    6.Packaging can gear to buyers’ special request. 

    Our service

    1. Reply your inquiry in 24 working hours.
    2. Customized design is available. OEM are welcomed.
    3. Exclusive and unique solution can be provided to our customer by our well-trained and professional engineers and
    staff.
    4. Professional factory: We are manufacturer, specializing in producing all kinds of herb extract for more than 10 years, competitive with good quantity.
    5. As an honest seller, we always use superior raw material, advanced machines, skilled technicians to ensure our products to be finished in high quality and stable feature.


    Hainan Flying International Trade Co., Ltd., was established in 2020, It is a professional supplier of Human APIs, Veterinary, Food Additives, Vitamins, Chemicals, Plant Extract and natural active ingredients. It has absolute advantage because of strong research strength, modern management system and high-quality marketing team.

    For customer’s needs, OEM service is also acceptable. If you have a good idea in new product production but lack of laboratory device and human resource, we are glad to solve this problem for you. Sincerely hope to strengthen exchanges and cooperation with friends from both home and abroad.

    .






    Shop 5-Methoxy tryptamine 608-07-1 Crystalline powder-Detailed Image 1

    Shop 5-Methoxy tryptamine 608-07-1 Crystalline powder-Detailed Image 2

    Shop 5-Methoxy tryptamine 608-07-1 Crystalline powder-Detailed Image 3



    Shop 5-Methoxy tryptamine 608-07-1 Crystalline powder-Detailed Image 5

    Shop 5-Methoxy tryptamine 608-07-1 Crystalline powder-Detailed Image 6

    Shop 5-Methoxy tryptamine 608-07-1 Crystalline powder-Detailed Image 7


    RAQ





    Q1: How to confirm the Product Quality before placing orders?
    A: By sending you available samples. Or if you have special requirements for the goods, we can prepare samples according to your requirement for confirmation.

    Q2: Can you supply free samples?
    A: Yes, we can provide a free sample, but the shipping cost will be paid by the customers. You can either pay the shipping cost or arrange a courier to collect the samples.

    Q3: How do you treat quality complaints?
    A: All our products are strictly tested by our QC and confirmed by QA; unqualified material will not be released to customers. In case any quality problem is confirmed to be caused by us, we will replace the goods or refund your payment immediately.

    Q4: What's your MOQ ?
    A: For the high value product, our MOQ starts from 1g and generally starts from 10gs. For other low, price product, our MOQ starts from 100g and 1kg.
    Q: Is there a discount ?
    A: Yes, for larger quantity, we always support with better price.

    Q5: How to start orders or make payments ?
    A: You can send our your Purchase order ( if your company has ), or just send a simple confirmation by email or by Trade Manager, and we will send you Proforma Invoice with our bank details for your confirmation, then you can make payment accordingly.


    Basic Info
    Product Name:

    LL-37

    Other Name:

    Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

    CAS No.:

    154947-66-7

    Molecular Formula:

    C205H340N60O53

    InChIKeys:

    POIUWJQBRNEFGX-XAMSXPGMSA-N

    Molecular Weight:

    0

    EC Number:

    211-519-9

    Color/Form:

    White to off-white

    Categories:

    Nutrition Supplements

    Characteristics
    Water Solubility:

    Soluble to 1 mg/ml in water

  • Seller Information
    Business Type:

    Trader

    Main Products:

    vitamin

    Location:

    Room 2-502, Building 6, Luneng Tehran Garden Building, No.8 Changbin Road, Xiuying district, Haikou City, Hainan Province

    Payment Terms:

    TT against copy of documents,TT against B/L draft before shipment

    Average lead Time:

    25

    Total Annual Revenue:

    $2.5 million-$5 million

    Total Employees:

    Less than 5

    Year of Establishment:

    2023

  • Inquiry History
    1 Inquiries
    Country Product Purchase Quantity Date Posted
    Indonesia

    LL-37

    5 MG Jun 23, 2026
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.