Product
Supplier
Encyclopedia
Inquiry
Home > Cosmetic Ingredient > Abrasive > LL-37 for Sale > TB500 Thymosin CAS154947-66-7 B4 Acetate LL37 GHK-CU BT5 BT10 375 CU50 CU100 Customized peptides
TB500 Thymosin CAS154947-66-7 B4 Acetate LL37 GHK-CU BT5 BT10 375  CU50 CU100  Customized peptides buy - large image1
TB500 Thymosin CAS154947-66-7 B4 Acetate LL37 GHK-CU BT5 BT10 375  CU50 CU100  Customized peptides buy - image1
TB500 Thymosin CAS154947-66-7 B4 Acetate LL37 GHK-CU BT5 BT10 375  CU50 CU100  Customized peptides buy - image2
TB500 Thymosin CAS154947-66-7 B4 Acetate LL37 GHK-CU BT5 BT10 375  CU50 CU100  Customized peptides buy - image3
TB500 Thymosin CAS154947-66-7 B4 Acetate LL37 GHK-CU BT5 BT10 375  CU50 CU100  Customized peptides buy - image4
TB500 Thymosin CAS154947-66-7 B4 Acetate LL37 GHK-CU BT5 BT10 375  CU50 CU100  Customized peptides buy - image5
TB500 Thymosin CAS154947-66-7 B4 Acetate LL37 GHK-CU BT5 BT10 375  CU50 CU100  Customized peptides buy - image6

TB500 Thymosin CAS154947-66-7 B4 Acetate LL37 GHK-CU BT5 BT10 375 CU50 CU100 Customized peptides

TDS 1 Inquiries

Unit Price:

$1/G FOB

Get Latest Price
CAS No.:

154947-66-7

Grade:

Pharmaceutical Grade

Content:

99%

Port:

shenzhen

Brand:

sc

Packaging:

5mg/ 10mg/ 50 mg/ 100 mg. 10 bottles per box

Price valid (until):

2027-10-31

Company Type:
Trader
Location:
Hongkong, China
Qualification:
Main Products:

tr

  • Product Description

  • Seller Information

  • Inquiry History

  • Description

    Sales manager: Sofia

    WhatsApp:+85244569741

    Sincerely look forward to your inquiries about our products.


    ——      Product Detail      ——

    Cutting-Edge Technological Capabilities​

    Peptide’s technical prowess lies in our mastery of advanced peptide synthesis and optimization technologies, which underpin the superior performance of our products. We leverage state-of-the-art processes to push the boundaries of peptide science:​

    Advanced Synthesis Technologies: Expertise in solid-phase peptide synthesis (SPPS), microwave-assisted synthesis, and segment ligation allows us to produce complex peptides—including linear, cyclic, and highly modified variants—that many competitors cannot replicate.​

    AI-Powered Optimization: Our proprietary AI platform analyzes peptide sequences to enhance bioactivity, stability, and bioavailability, reducing clients’ R&D costs by minimizing trial-and-error and accelerating product development.​

    Robust IP Portfolio: We hold multiple patents for innovative synthesis methods and peptide formulations, reflecting our commitment to technological leadership and providing clients with exclusive, market-differentiating solutions.


    Shop Semaglutide CAS910463-68-2 Tirzepatide Retatrutide SM2 SM5 SM10 SM15 SM20 SM30 Transport safety is improving rapidly-Detailed Image 1

    It can prevent the skin from producing melanin, achieving the effect of whitening, fading spots and even out skin tone. In addition, it has anti-inflammatory effects, which can reduce skin inflammation, prevent premature aging, and promote healthy and youthful skin.


    Shop Semaglutide CAS910463-68-2 Tirzepatide Retatrutide SM2 SM5 SM10 SM15 SM20 SM30 Transport safety is improving rapidly-Detailed Image 2

    ——      Our advantage    ——

    1. We supply Peptides, APIs & Intermediates and so on to satisfy your needs;
    2. We will reply you for your inquiry in 24 hours;
    3. Strictly on selecting raw materials . Our Q&C team will inspect every product quality strictly before delivery;

    4. Reasonable & competitive price, fast lead time ;

    5. After delivery, we will track the products for you once every two days, until you get the products. When you got the goods, if you have any questions about the problem, contact with us, we will offer the solve way for you ;

    6. 100% safe delivery, guaranteed delivery.

    Shop Semaglutide CAS910463-68-2 Tirzepatide Retatrutide SM2 SM5 SM10 SM15 SM20 SM30 Transport safety is improving rapidly-Detailed Image 3

    Shop Semaglutide CAS910463-68-2 Tirzepatide Retatrutide SM2 SM5 SM10 SM15 SM20 SM30 Transport safety is improving rapidly-Detailed Image 4

    ——      Storage Conditions     ——

    Peptide Storage Guidelines: General Tips

    When storing peptides, remember to:
    • Store peptide in a cold, dry, dark place
    • Avoid repeated freezing and thawing of peptide
    • Avoid overexposure to the air
    • Avoid light exposure
    • Avoid storing peptides in solution long term
    • Aliquot peptide according to experimental requirements

    Shop Semaglutide CAS910463-68-2 Tirzepatide Retatrutide SM2 SM5 SM10 SM15 SM20 SM30 Transport safety is improving rapidly-Detailed Image 5

    ——      Why Choose Us      ——

    1. 1.High Purity Our peptide products undergo advanced purification processes, achieving extremely high purity with minimal impurity content. This ensures the stability and effectiveness of the products, making them a reliable choice for various applications, such as scientific research, beauty skincare, and healthcare. Whether for academic research or commercial use, our products offer a quality guarantee.
    2. 2.Strong Activity Through our unique production process, we maximize the retention of biological activity in peptides, allowing them to be quickly absorbed and utilized by the human body to exert their full effects. For example, in beauty skincare, active peptides promote collagen production and improve skin elasticity. In healthcare, peptides enhance immunity and regulate body functions.
    3. 3.Customization Service We have a professional R&D team that can customize and synthesize various peptides with specific sequences and functions based on your needs. Whether it's for drug research and development, biological detection, or other specialized fields, we can meet your personalized requirements.
    4. 4.Price We combine industry and trade, and with 12 years of experience, we are able to provide competitive prices and high-quality products.
    5. 5.Packaging & Transportation We can package according to customer requirements and customize products. For transportation, we handle door-to-door delivery, eliminating the need for you to manage any customs clearance.

    Shop Selank CAS129954-34-3 SK5 SK10 High purity Dual guarantee for high-quality transportation-Detailed Image 9 Shop Selank CAS129954-34-3 SK5 SK10 High purity Dual guarantee for high-quality transportation-Detailed Image 10 Shop Selank CAS129954-34-3 SK5 SK10 High purity Dual guarantee for high-quality transportation-Detailed Image 11

    ——        Customer Feedback       ——

    Shop Selank CAS129954-34-3 SK5 SK10 High purity Dual guarantee for high-quality transportation-Detailed Image 12

    ——      Packing & Delivery     ——

    Shop Selank CAS129954-34-3 SK5 SK10 High purity Dual guarantee for high-quality transportation-Detailed Image 13 Shop Selank CAS129954-34-3 SK5 SK10 High purity Dual guarantee for high-quality transportation-Detailed Image 14 Shop Semaglutide CAS910463-68-2 Tirzepatide Retatrutide SM2 SM5 SM10 SM15 SM20 SM30 Transport safety is improving rapidly-Detailed Image 12  Shop Selank CAS129954-34-3 SK5 SK10 High purity Dual guarantee for high-quality transportation-Detailed Image 16 Shop Selank CAS129954-34-3 SK5 SK10 High purity Dual guarantee for high-quality transportation-Detailed Image 17

    Welcome to be our distinguished customer,please do not hesitate to contact us!


    Certificates
    • TB500 Thymosin CAS154947-66-7 B4 Acetate LL37 GHK-CU BT5 BT10 375  CU50 CU100  Customized peptides Certificates 1

    Basic Info
    Product Name:

    LL-37

    Other Name:

    Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

    CAS No.:

    154947-66-7

    Molecular Formula:

    C205H340N60O53

    InChIKeys:

    POIUWJQBRNEFGX-XAMSXPGMSA-N

    Molecular Weight:

    0

    EC Number:

    211-519-9

    Color/Form:

    White to off-white

    Categories:

    Abrasive

    Characteristics
    Water Solubility:

    Soluble to 1 mg/ml in water

  • Seller Information
    Business Type:

    Trader

    Main Products:

    tr

    Location:

    B27 SHING LEE COMM BLDG 8WING KUT ST CENTRAL HONGKONG

    Average lead Time:

    1

    Total Annual Revenue:

    Less than $1 million

    Total Employees:

    5-10

    Year of Establishment:

    2026

    20 years of production experience in peptide products

    Safe and unobstructed shipping channels|High quality guaranteed|

    Our company is located in Guangzhou, China. Its production facilities are situated in a modern 5,000-square-meter factory. As a private enterprise, we have over 200 professional employees and are actively expanding our team to support future growth. Over the past two decades, as a comprehensive enterprise integrating research, production, processing and export in the chemical industry, we have performed exceptionally well. Since our establishment, we have always adhered to the principles of "honest management, strict quality control, and customer-oriented service", and have received continuous praise from global customers. Our company is a Chinese manufacturer of peptide products, guaranteeing product quality and effectiveness at affordable prices. We offer reliable and secure shipping channels with discreet delivery to ensure safe and timely arrival.


  • Inquiry History
    1 Inquiries
    Country Product Purchase Quantity Date Posted
    Indonesia

    LL-37

    5 MG Jun 23, 2026
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.