Product
Supplier
Encyclopedia
Inquiry
Home > Pharmaceutical Intermediates > Bulk Drug Intermediates > LL-37 for Sale > LL37 SS31 TB500 99% freeze dried powder cas154947-66-7 senwayer
LL37  SS31  TB500 99% freeze dried powder cas154947-66-7 senwayer buy - large image1
LL37  SS31  TB500 99% freeze dried powder cas154947-66-7 senwayer buy - image1
LL37  SS31  TB500 99% freeze dried powder cas154947-66-7 senwayer buy - image2
LL37  SS31  TB500 99% freeze dried powder cas154947-66-7 senwayer buy - image3
LL37  SS31  TB500 99% freeze dried powder cas154947-66-7 senwayer buy - image4
LL37  SS31  TB500 99% freeze dried powder cas154947-66-7 senwayer buy - image5
LL37  SS31  TB500 99% freeze dried powder cas154947-66-7 senwayer buy - image6

LL37 SS31 TB500 99% freeze dried powder cas154947-66-7 senwayer

TDS

Unit Price:

$8-10/UNIT FOB

Get Latest Price
CAS No.:

154947-66-7

Grade:

Pharmaceutical Grade

Content:

99.87%

Port:

hongkong

Brand:

Customization Available

Packaging:

5mg*1vials/box,10mg*1vials/box

Price valid (until):

2026-07-01

Company Type:
Trader
Location:
China
Qualification:
Main Products:

Retatrutide,Tirzepatide,GLOW,KLOW80,NAD+,TB500

  • Product Description

  • Seller Information

  • Description

    contact information:

    Name: Anna

    Email address : xiaobo19872026@outlook.com

    Whatsapp : +85244588108

    Telegram : @anna20260512


    Items Specifications
    Product Name   LL37
    CAS  154947-66-7
    Appearance White power



    Peptide

    Peptide products offer diverse functional benefits across multiple scenarios:

    in health management, peptides support metabolic regulation (aiding in blood sugar control and healthy weight management for specific groups) and immune system modulation by enhancing the body's defense responses; 

    in skincare, peptides promote skin barrier repair, boost collagen synthesis to reduce fine lines, and improve skin hydration and elasticity; 

    in sports nutrition, peptides assist in muscle recovery by reducing post-exercise tissue damage and supporting muscle protein synthesis.

    Why Choose Our Peptides?

    • Clinically Relevant: Aligns with global trends in peptide therapeutics, a market projected to reach $83.75B by 2034 .
    • Quality Assured: Sourced from trusted manufacturers with reliable global distribution, ensuring consistency and potency .
    • Holistic Support: Complements weight management programs, metabolic health goals, and sleep apnea treatment plans—addressing root causes for lasting impact .

    Key Search Terms:

    Prescription peptide for weight loss, obesity peptide therapy, OSA treatment peptides, high-purity weight loss peptides, custom peptides formulations, GLP-1 related peptides,  peptide for weight management, peptide supplements for metabolic health
    Customizable peptide
    Skin care peptide
    Beauty peptide
    Muscle building peptide
    Hair growth peptide
    Weight loss peptide
    Fitness peptide

    Company Profile

    Our company is a modern and advanced enterprise, specializing in the production and export of raw materials for drugs, drug intermediates, and plant extracts. Our products are widely used in the fields of medicine, medical health products, cosmetics, nutritional supplements, and food additives. Our factory covers an area of 95 acres. The proposed factory will comply with GMP standards. The factory environment is clean and tidy, with a reasonable layout, and includes large and medium-sized production workshops as well as shared workshops. It is equipped with advanced equipment, quality inspection and research centers. These products have reached the advanced domestic level in terms of quality and technical content. Since its establishment, the company has attached great importance to team training and technological reform. Our modern production equipment ensures the rapid and efficient production of the entire line, with high precision. All processing, extraction, packaging and transportation are completed internally, ensuring the highest quality and efficiency. We continuously develop new ingredients and innovative products, earning respect and praise from global customers. After years of continuous development, the company has accumulated rich experience in international trade and customer resources, established a stable customer base and a complete marketing service network. In addition, the company has established long-term technical cooperation relationships with experts and professors from many universities and research institutions in the province.

    Shop LL37  SS31  TB500 99% freeze dried powder cas154947-66-7 senwayer-Detailed Image 1

       Shop The original Chinese product, Klow rt ghk cu   freeze-dried powder, is used for tissue regeneration and anti-inflammation.-Detailed Image 5 Shop LL37  SS31  TB500 99% freeze dried powder cas154947-66-7 senwayer-Detailed Image 3 Shop LL37  SS31  TB500 99% freeze dried powder cas154947-66-7 senwayer-Detailed Image 4 Shop LL37  SS31  TB500 99% freeze dried powder cas154947-66-7 senwayer-Detailed Image 5 Shop LL37  SS31  TB500 99% freeze dried powder cas154947-66-7 senwayer-Detailed Image 6 Shop LL37  SS31  TB500 99% freeze dried powder cas154947-66-7 senwayer-Detailed Image 7 Shop LL37  SS31  TB500 99% freeze dried powder cas154947-66-7 senwayer-Detailed Image 8   Shop The original Chinese product, Klow rt ghk cu   freeze-dried powder, is used for tissue regeneration and anti-inflammation.-Detailed Image 8 Shop The original Chinese product, Klow rt ghk cu   freeze-dried powder, is used for tissue regeneration and anti-inflammation.-Detailed Image 9 Shop The original Chinese product, Klow rt ghk cu   freeze-dried powder, is used for tissue regeneration and anti-inflammation.-Detailed Image 10 Shop The original Chinese product, Klow rt ghk cu   freeze-dried powder, is used for tissue regeneration and anti-inflammation.-Detailed Image 11 Shop The original Chinese product, Klow rt ghk cu   freeze-dried powder, is used for tissue regeneration and anti-inflammation.-Detailed Image 12 Shop LL37  SS31  TB500 99% freeze dried powder cas154947-66-7 senwayer-Detailed Image 14 Shop The original Chinese product, Klow rt ghk cu   freeze-dried powder, is used for tissue regeneration and anti-inflammation.-Detailed Image 15

    Shop The original Chinese product, Klow rt ghk cu   freeze-dried powder, is used for tissue regeneration and anti-inflammation.-Detailed Image 16

    FAQ

    Q1: About the after-sale service

    A: After purchasing the products from our Lab, we have A professional technical team and after-sales team to serve you and solve all your problems in the future


    Q2: Do you have stock?

    A: We understand most customers prefer stock, so we'll try to keep stock for most products. However, for some rare products, we won't keep stock and it needs time to synthesize.


    Q3: How do I start paying?

    Payment can be made by Bitcoin,wire transfer or paypal


    Q4: How to confirm product quality before placing an order?

    A: We got good feedback from customers and Tested by third-party institutions. You also can get free samples of some products. You just have to pay the shipping fee for the sample .

    You can send us your product specifications and requirements and we can customize for you.


    Q5: What is your MOQ?

    A: The minimum quantity we can order is 1 box.

    But usually we can accept a smaller quantity, say 100g, at the cost of 100% sample charge.


    Q6: Time for delivery?

    A: Leading time within 3 business days,Shipping time about 8-10 business days. 


    Q7: Why should I choose you?

    A: Powerful technical support-come from our highly skilled & fully experienced staff, working in chemical industry for over 5years, in average.Strict quality control-comes form our sophisticated management system.Professional and warm sales team-since we believe we can only win via our hard work in a competitive world.Quick response and excellent presale and after sale service-since we believe our customers deserve all the best service.

    Certificates
    • LL37  SS31  TB500 99% freeze dried powder cas154947-66-7 senwayer Certificates 1

    Basic Info
    Product Name:

    LL-37

    Other Name:

    Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

    CAS No.:

    154947-66-7

    Molecular Formula:

    C205H340N60O53

    InChIKeys:

    POIUWJQBRNEFGX-XAMSXPGMSA-N

    Molecular Weight:

    0

    EC Number:

    211-519-9

    Color/Form:

    White to off-white

    Characteristics
    Water Solubility:

    Soluble to 1 mg/ml in water

  • Seller Information
    Business Type:

    Trader

    Main Products:

    Retatrutide,Tirzepatide,GLOW,KLOW80,NAD+,TB500

    Location:

    Room 11B, Building 0056, No. 81-1 Nonglinxia Road, Yuexiu District, Guangzhou City, Guangdong Province

    Total Annual Revenue:

    $1 million-$2.5 million

    Total Employees:

    5-10

    Year of Establishment:

    2026

  • Country Product Purchase Quantity Date Posted
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.