Product
Supplier
Encyclopedia
Inquiry
Home > Active Pharmaceutical Ingredients > Other Chemical Drugs > LL-37 for Sale > SUR10 High quality, in stock, fast delivery, and discounts for large quantities
SUR10 High quality, in stock, fast delivery, and discounts for large quantities buy - large image1
SUR10 High quality, in stock, fast delivery, and discounts for large quantities buy - image1
SUR10 High quality, in stock, fast delivery, and discounts for large quantities buy - image2
SUR10 High quality, in stock, fast delivery, and discounts for large quantities buy - image3
SUR10 High quality, in stock, fast delivery, and discounts for large quantities buy - image4
SUR10 High quality, in stock, fast delivery, and discounts for large quantities buy - image5
SUR10 High quality, in stock, fast delivery, and discounts for large quantities buy - image6

SUR10 High quality, in stock, fast delivery, and discounts for large quantities

TDS 1 Inquiries

Unit Price:

$1-1.3/MT FOB

Get Latest Price
CAS No.:

154947-66-7

Grade:

Cosmetics Grade

Content:

99.9%

Port:

SHENZHEN

Brand:

customization

Packaging:

10 pieces per box

Price valid (until):

2026-10-17

Company Type:
Trader
Location:
Hongkong, China
Qualification:
Main Products:

polypeptide,GHK-CU,NAD+,Tirzepatide,GLutathione

  • Product Description

  • Seller Information

  • Inquiry History

  • Description


      Product Detail  



    WhatsApp:85265574617 Shop DS15 High quality, in stock, fast delivery, and discounts for large quantities-Detailed Image 1 Shop DS15 High quality, in stock, fast delivery, and discounts for large quantities-Detailed Image 2 Shop DS15 High quality, in stock, fast delivery, and discounts for large quantities-Detailed Image 3 Shop DS15 High quality, in stock, fast delivery, and discounts for large quantities-Detailed Image 4 Shop DS15 High quality, in stock, fast delivery, and discounts for large quantities-Detailed Image 5 Shop DS15 High quality, in stock, fast delivery, and discounts for large quantities-Detailed Image 6 Shop DS15 High quality, in stock, fast delivery, and discounts for large quantities-Detailed Image 7 Shop DS15 High quality, in stock, fast delivery, and discounts for large quantities-Detailed Image 8 Shop DS15 High quality, in stock, fast delivery, and discounts for large quantities-Detailed Image 9 Shop DS15 High quality, in stock, fast delivery, and discounts for large quantities-Detailed Image 10   


    I. Core Foundation:
    1. GLP-1 receptor pathway (distributed throughout the body in multiple organs: brain, stomach, pancreas, liver)
    Simulates the intestinal incretin GLP-1 secreted by the human intestine, responsible for controlling calorie intake and maintaining stable blood sugar:
    - Hypothalamic appetite center: inhibits hunger signals, amplifies satiety signals;
    - Gastrointestinal tract: slows down gastric emptying speed, prolongs the duration of satiety;
    - Pancreatic β cells: glucose-dependent secretion, lowers blood sugar when it is high, automatically weakens when blood sugar is low, rarely causes hypoglycemia;
    - Pancreatic α cells: inhibits excessive secretion of glucagon, reduces abnormal sugar production by the liver;
    - Mildly regulates liver and fat metabolism, assisting in reducing lipid accumulation.
    2. Glucagon GCGR pathway (highly expressed in liver, white/brown fat)
    This is the "fat-burning engine" lacking in single-target GLP-1 drugs, responsible for enhancing metabolism and breaking down fat:
    - Liver cells: significantly activates fat β-oxidation and glycogen breakdown, forcibly mobilizing liver and visceral fat for energy supply;
    - Fat tissue: stimulates lipolysis, breaks down triglycerides to release free fatty acids;
    - Whole-body thermogenesis: increases the resting basal metabolic rate, passively increasing total daily calorie consumption;
    - Does not increase the risk of blood sugar elevation: The GLP-1 pathway counteracts the potential blood sugar-raising effect of GCGR, achieving a two-way balance of blood sugar homeostasis.
    3. Dual receptor synergy logic
    GLP-1 regulates less eating (throttling), GCGR regulates more burning (opening up resources), the two pathways do not cancel each other out but mutually enhance each other:
    Single GLP-1 only reduces food intake, but the basal metabolism is likely to decrease with weight loss; combined with GCGR, metabolism does not decline, fat loss efficiency doubles, and targeted removal of visceral and liver ectopic fat is achieved.
    II. Strong appetite suppression, prolonging satiety, reducing food intake at the source (GLP-1 dominant, GCGR assisting)
    1. Central inhibition of appetite (brain hypothalamus)
    Activates the satiety center in the arcuate nucleus of the hypothalamus and inhibits the hunger center:
    - Reduces the desire for high-calorie, sweet foods, snacks, and reduces the urge for binge eating;
    - Reduces the secretion of ghrelin (hunger hormone), enhances leptin sensitivity, and long-term improves the tendency to be hungry.
    2. Peripheral prolongation of satiety (gastrointestinal tract)
    - Prolongs gastric emptying: food stays in the stomach for a significantly longer time, a small amount of food causes a strong feeling of fullness;
    - Slows down intestinal peristalsis, reduces rapid hunger after meals;
    - Reduces gastric acid secretion after meals, reduces the urge to eat.
    3. GCGR assists in consolidating the effect of controlling food intake
    After GCGR activation, fat continues to break down for energy supply, the body is less likely to quickly experience hunger, significantly reducing the urge for nocturnal and pre-meal binge eating.
    III. Enhance liver fat breakdown, increase total daily calorie consumption (GCGR core function, GLP-1 enhancing effect)
    (1) Liver: Strongly breaks down liver fat, reversing the core pathway of fatty liver
    1. Activates liver cells' GCGR, increases intracellular cAMP, initiates fat acid β-oxidation: directly breaks down the accumulated triglycerides in liver cells, reduces lipid droplet deposition;
    2. Inhibits liver fat from de novo synthesis (DNL): blocks the conversion of sugar to liver fat, reducing the progression of fatty liver from the source;
    3. Promotes the outward transport of liver lipids: transports liver fat to systemic tissues for oxidation for energy supply, reduces the degree of liver fat infiltration;
    4. Reduces liver inflammation: after the accumulation of fat decreases, the inflammation of liver lobules and ballooning degeneration of liver cells are simultaneously alleviated, improving metabolic-related fatty liver (MASLD) and even early fatty liver inflammation (MASH).
    (2) Total calorie consumption increase (passive fat burning, not dependent on exercise)
    1. Increases resting basal metabolism: GCGR stimulates liver heat production, activates brown fat heat production, calorie consumption during rest is significantly higher than simple dieting/single-target GLP-1; 2. Continuously mobilize internal visceral fat: Prioritize the breakdown of abdominal and visceral fat (the most harmful abdominal obesity fat) rather than simply subcutaneous water;
    3. Reduce metabolic adaptation: During regular dieting for weight loss, the body automatically lowers metabolism to "save energy and survive", while the SUR10 GCGR pathway can counteract this metabolic decline, avoiding weight loss plateaus and rebounds.
    4. Losing fat while maximizing muscle retention, simultaneously improving fatty liver and glucose metabolism
    1. Mechanism for losing fat while preserving muscle (distinguishing from regular dieting and partial weight loss drugs)
    1. Energy supply prioritizes fat rather than muscle protein
    The GCGR continuously mobilizes fat as the main energy source, and the body does not need to break down skeletal muscle protein for energy supply; when the calorie gap is large in simple dieting or partial weight loss plans, muscle will be lost simultaneously, and the basal metabolism will decrease further.
    2. The GLP-1 pathway protects the muscle synthesis signal
    Improving overall sensitivity is the key hormone for muscle protein synthesis; the glucose uptake by muscle cells increases, maintaining the rate of muscle protein synthesis, and reducing muscle loss.
    3. Reduce inflammation and lower muscle breakdown factors
    After reducing visceral fat, the low-grade chronic inflammation throughout the body is relieved, and inflammatory factors will accelerate muscle breakdown; SUR10 reduces the level of inflammation and maintains muscle mass, resulting in a firm and non-sagging body shape after weight loss, and retaining the basal metabolism.
    2. Complete improvement chain for fatty liver (MASLD/MASH)
    1. Short term: Rapidly reduce the triglyceride content in the liver, reduce liver fat infiltration;
    2. Mid term: Alleviate hepatic steatosis, reduce liver inflammatory infiltration;
    3. Long term: Improve liver resistance, break the vicious cycle of "fat accumulation → insulin resistance → more fat deposition";

    Items Specifications
    Product Name SUR10
    Purity 99.9%
    Storage Condition Seal and store in cool dry place


      Company Profile 


    Hong Kong Biopetide Research Limited is a high-tech enterprise specializing in the research, development, production, and sales of peptide products. The company boasts advanced laboratories and a rigorous quality control system, with its products having obtained multiple international certifications, ensuring safety and efficacy.
    Its customers are spread across Europe, the United States, Southeast Asia, the Middle East, and other regions.
    Biotechnology Co., Ltd. is a high-tech enterprise specializing in the research, development, production, and sales of peptide products. With advanced laboratories and a rigorous quality control system, our products have obtained international certification, ensuring safety and efficacy.
    As a global trading company, we provide customized solutions to customers across Europe, the United States, Southeast Asia, the Middle East, and many other regions. Upholding the philosophy of "technology leading health," we are committed to innovation, striving to deliver high-quality health products to consumers worldwide. Our business principles focus on establishing a strong domestic market presence, increasing R&D investment, manufacturing premium products, and leveraging technology to promote environmental protection and sustainable development. At the same time, we actively expand into international markets, serve society with sincerity, and aim to become a modern, eco-friendly, and technologically advanced enterprise that meets global standards. Contact Us

    Our products have been exported to 130 countries and regions. We are committed to building stable, strategic, and long-term partnerships with suppliers and customers both domestically and internationally, working together to create a brighter future.


      Common Problem  


    1. We are the source factory of raw materials, offering high-quality and high-purity raw materials at wholesale prices.
    2. We can provide global delivery services and have an exclusive delivery team to ensure safety and speed.
    3. You can contact us to inquire about any products. Our product range is extensive and we support customization to meet your needs as much as possible.
    4. We support various payment methods and all details can be negotiated.
    5. If you have any questions, please feel free to contact me. I will do my best to answer your questions for you.
    6. Firstly, we guarantee the quality of the products; secondly, we guarantee the efficiency of transportation and the clearance rate; thirdly, we will provide you with the best service in all aspects.

    You get what you pay for. If you have any questions, I will answer them all.


      Mode of transportation  


    We mainly adopt dedicated logistics and FedEx transportation methods, which can ensure timely shipment, quick delivery, stable logistics tracking, and safe and punctual delivery.

    Shop Lemon bottle High quality, in stock, fast delivery-Detailed Image 9 Shop FM2 High quality, in stock, fast delivery, and discounts for large quantities-Detailed Image 12

    Certificates
    • SUR10 High quality, in stock, fast delivery, and discounts for large quantities Certificates 1

    Basic Info
    Product Name:

    LL-37

    Other Name:

    Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

    CAS No.:

    154947-66-7

    Molecular Formula:

    C205H340N60O53

    InChIKeys:

    POIUWJQBRNEFGX-XAMSXPGMSA-N

    Molecular Weight:

    0

    EC Number:

    211-519-9

    Color/Form:

    White to off-white

    Categories:

    Other Chemical Drugs

    Characteristics
    Water Solubility:

    Soluble to 1 mg/ml in water

  • Seller Information
    Business Type:

    Trader

    Main Products:

    polypeptide,GHK-CU,NAD+,Tirzepatide,GLutathione

    Location:

    Room 5003, 5/F, Lee Yu Centre, 45 Hoi Yuen Road, Kwun Tong, Hong Kong

    Year of Establishment:

    2026

  • Inquiry History
    1 Inquiries
    Country Product Purchase Quantity Date Posted
    Indonesia

    LL-37

    5 MG Jun 23, 2026
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.