Product
Supplier
Encyclopedia
Inquiry
Home > Pharmaceutical Intermediates > Bulk Drug Intermediates > LL-37 for Sale > LL37 5mg 15+yeras API,Raw, Peptide factory supplier
LL37 5mg 15+yeras API,Raw, Peptide factory supplier buy - large image1
LL37 5mg 15+yeras API,Raw, Peptide factory supplier buy - image1
LL37 5mg 15+yeras API,Raw, Peptide factory supplier buy - image2
LL37 5mg 15+yeras API,Raw, Peptide factory supplier buy - image3
LL37 5mg 15+yeras API,Raw, Peptide factory supplier buy - image4
LL37 5mg 15+yeras API,Raw, Peptide factory supplier buy - image5
LL37 5mg 15+yeras API,Raw, Peptide factory supplier buy - image6

LL37 5mg 15+yeras API,Raw, Peptide factory supplier

TDS

Unit Price:

$10-12/UNIT FOB

Get Latest Price
CAS No.:

154947-66-7

Grade:

Pharmaceutical Grade

Content:

99%

Port:

HONGKONG

Brand:

LN

Packaging:

5mg/vial; 10vials/kit

Price valid (until):

2026-07-04

Company Type:
Manufactory
Location:
China
Qualification:
Main Products:

Semaglutide,Tirzepatide,Retatrutide,Pharmaceutical Peptide,Cosmetic peptide,Custom peptides

  • Product Description

  • Seller Information

  • Description


      Product Detail  


    Name: LL37 5mg

    CAS No.: 154947-66-7

    Purity: >99% (or refer to the Certificate of Analysis)

    Storage Condition: Dry, dark and at 0 - 4 C for short term (days to weeks) or -20 C for long term (months to years).

    Shelf Life: >2 years if stored properly

    Stock Solution Storage: 0 - 4 C for short term (days to weeks), or -20 C for long term (months).

    LL‑37 is the only human cathelicidin antimicrobial peptide, derived from the hCAP18 protein. It is a 37‑amino acid cationic, amphipathic α‑helical peptide with broad immunomodulatory and host defense functions.
    CAS Number: 154947-66-7
    It exhibits potent antimicrobial activity against Gram‑positive and Gram‑negative bacteria, fungi, and enveloped viruses. Beyond direct microbial killing, LL‑37 regulates inflammation, promotes wound healing, modulates immune cell recruitment, and supports tissue repair. It is widely studied in immunology, dermatology, infection research, and mucosal defense.

    Production:
    Manufactured via solid-phase peptide synthesis (SPPS), followed by purification and lyophilization to obtain the final product.


    NOTE: This product was prepared by chemical synthesis. Used only for research. Not for human use.

    Items Specifications
    CAS 154947-66-7
    Shelf life >2 years if stored properly
    Appearance Powder
    Purity >99%  (or refer to the Certificate of Analysis)
    Transportation By Air
    Origin China
    Specification 5mg/vial, 10vial/kit
    Storage condition Dry, dark, low temperature

    Shop LL37 5mg 15+yeras API,Raw, Peptide factory supplier-Detailed Image 1 Shop LL37 5mg 15+yeras API,Raw, Peptide factory supplier-Detailed Image 2 Shop LL37 5mg 15+yeras API,Raw, Peptide factory supplier-Detailed Image 3

    Shop LL37 5mg 15+yeras API,Raw, Peptide factory supplier-Detailed Image 4

    Shop LL37 5mg 15+yeras API,Raw, Peptide factory supplier-Detailed Image 5 Shop LL37 5mg 15+yeras API,Raw, Peptide factory supplier-Detailed Image 6


       Advantage


    1. Ultra-High Purity

    Each batch is synthesized and purified to >99% purity, ensuring reliable and reproducible results in sensitive experiments.


    2.Accurate Dosing & Consistency
    Our peptides are precisely weighed and vacuum-sealed under sterile conditions. Batch-to-batch consistency is rigorously maintained.


    3.Endotoxin-Free & Sterile Processing
    Manufactured in a cleanroom environment, our peptides are free from endotoxins, microbial contamination, and other impurities that could interfere with cell-based or in vivo studies.

    Shop LL37 5mg 15+yeras API,Raw, Peptide factory supplier-Detailed Image 7


      Global Service


    Who We Serve


    -We proudly work with clients across North America, Europe, Asia, and Latin America, including:

    -Biotech and pharma firms

    -Research institutions & universities

    -Peptide formulation startups

    -CDMOs and CRO partners

    Shop LL37 5mg 15+yeras API,Raw, Peptide factory supplier-Detailed Image 8


      About Us


    We are a chemical manufacturer integrating production, processing and export, mainly dealing in pharmaceutical intermediates and various industrial chemicals. Since its establishment, the company adheres to the spirit of "integrity management, strict quality control, customer first", and has won praise from customers at home and abroad. We have also established an excellent professional sales team with rich international marketing experience, able to efficiently provide a range of products and professional services.


    With synthetic biology platform technology as the core, it conducts innovative research and development, mainly engaged in the research and development of recombinantly expressed pharmaceutical peptides and proteins. Its products include innovative drugs, APIs, pharmaceutical and green synthetic industrial enzymes, functional peptides and protein products, etc.


    At present, our company has realized the industrialization of a variety of biosynthetic peptide products and has obtained cooperation orders from many well-known domestic and foreign pharmaceutical companies.

    Shop LL37 5mg 15+yeras API,Raw, Peptide factory supplier-Detailed Image 9 Shop LL37 5mg 15+yeras API,Raw, Peptide factory supplier-Detailed Image 10


       FQA


    1. How to make an order?

    Send me message and let me know what you need with quantity , then i will calculate to you.


    2. What's the lead time and shipping ways?

    We will delivery to the package by USPS, FEDEX, DHL paket and UPS express to you after receive your payment, it would take around 5-15 days to your address.


    3. How do i keep the peptides when I receive it ?

    Peptides in the form of lyophilized powder can be transported at room temperature by vacuum packaging, while polypeptides in the dissolved state need to be refrigerated at 2°C - 8°C. For long-term storage, peptides should be stored in the form of lyophilized powder store at -20°C or -80°C in a sealed container with desiccant, which can avoid the degradation of peptides to the greatest extent.

    Certificates

    Basic Info
    Product Name:

    LL-37

    Other Name:

    Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

    CAS No.:

    154947-66-7

    Molecular Formula:

    C205H340N60O53

    InChIKeys:

    POIUWJQBRNEFGX-XAMSXPGMSA-N

    Molecular Weight:

    0

    EC Number:

    211-519-9

    Color/Form:

    White to off-white

    Characteristics
    Water Solubility:

    Soluble to 1 mg/ml in water

  • Seller Information
    Business Type:

    Manufactory

    Main Products:

    Semaglutide,Tirzepatide,Retatrutide,Pharmaceutical Peptide,Cosmetic peptide,Custom peptides

    Location:

    Room 1502, Unit 3, Building 2, Nanshan Garden, Jianye 2nd Road, Guodu Subdistrict, Chang'an District, Xi'an City, Shaanxi Province, P.R.China

    Total Employees:

    101-200

    Year of Establishment:

    2017

    LN is a chemical manufacturer integrating production, processing and export, mainly dealing in pharmaceutical intermediates and various industrial chemicals. Since its establishment, the company adheres to the spirit of "integrity management, strict quality control, customer first", and has won praise from customers at home and abroad. We have also established an excellent professional sales team with rich international marketing experience, able to efficiently provide a range of products and professional services.

    With synthetic biology platform technology as the core, it conducts innovative research and development, mainly engaged in the research and development of recombinantly expressed pharmaceutical peptides and proteins. Its products include innovative drugs, APIs, pharmaceutical and green synthetic industrial enzymes, functional peptides and protein products, etc.

    At present, our company has realized the industrialization of a variety of biosynthetic peptide products and has obtained cooperation orders from many well-known domestic and foreign pharmaceutical companies.

  • Country Product Purchase Quantity Date Posted
    Post an enquiry for this product
pic ×

Scan the QR Code to Share

All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.

According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.

The information shown above is provided by the enterprise itself, and the authenticity, accuracy and legitimacy of the content are the responsibility of the publishing company. ECHEMI does not bear any guarantee responsibility for this. Please be aware that risks in internet transactions objectively exist.

Feedback & Suggestions
Send Message

Thank you for your feedback. If you require further assistance, please contact us by email at info@echemi.com or call us at +86-532-55729510.