 Home > Cosmetic Ingredient > Tonics > LL-37 for Sale > RT40 RT50 RT60 BC5 BC10 BC20 CAS154947-66-7 Safe delivery of personalized peptides

RT40 RT50 RT60 BC5 BC10 BC20 CAS154947-66-7 Safe delivery of personalized peptides buy - large image1

RT40 RT50 RT60 BC5 BC10 BC20 CAS154947-66-7 Safe delivery of personalized peptides buy - image1

RT40 RT50 RT60 BC5 BC10 BC20 CAS154947-66-7 Safe delivery of personalized peptides buy - image2

RT40 RT50 RT60 BC5 BC10 BC20 CAS154947-66-7 Safe delivery of personalized peptides buy - image3

RT40 RT50 RT60 BC5 BC10 BC20 CAS154947-66-7 Safe delivery of personalized peptides buy - image4

RT40 RT50 RT60 BC5 BC10 BC20 CAS154947-66-7 Safe delivery of personalized peptides

TDS 1 Inquiries

Unit Price:

$1/G FOB

Get Latest Price 

CAS No.:

154947-66-7

Grade:

Pharmaceutical Grade

Content:

99%

Port:

shenzhen

Brand:

Packaging:

5 mg /10 mg / 15 mg / 20 mg / 30 mg / 10 tubes per box

Price valid (until):

2027-01-22

Contact Supplier

 Chat Now

Chengtai Co., Ltd.

Company Type:

Trader

Location:

Hongkong, China

Qualification:

Main Products:

 Visit Store

Product Description
Seller Information
Inquiry History

Description

Product Detail

Business Manager: Hailey
WhatsApp: +852 7056 3242

Shop RT40 RT50 RT60 BC5 BC10 BC20 CAS154947-66-7 Safe delivery of personalized peptides-Detailed Image 1

1.We offer peptide products, raw materials and intermediates to meet your needs.

2. We will reply to your inquiries within 24 hours.

3. We strictly control raw materials. Our quality and purchasing teams will conduct strict quality inspections on each product before shipment.

4. The prices are reasonable and competitive, with prompt delivery.

5. After shipment, we will track the goods for you every two days until you receive the products. If you have any questions about the products after receiving them, please contact us and we will provide solutions.

6. 100% safe delivery, ensuring delivery.

Shop RT40 RT50 RT60 BC5 BC10 BC20 CAS154947-66-7 Safe delivery of personalized peptides-Detailed Image 2

We have many years of trading experience and are professional Chemical raw materials, medicine, Pharmaceutical raw material suppliers in overseas . Hope to cooperate with you for a long time and achieve win-win purpose. Our experienced staff is committed to strict quality control and attentive customer service and is always available to discuss your requirements and ensure complete customer satisfaction. Our company firmly believes that all products must comply with international quality standards. We therefore focus on sourcing quality materials and ensuring strict internal process controls. Our professional inspectors ensure that the products delivered to our customers are perfect. Our company adhere to the "customer first, reputation assurance, quality assurance, professional service" policy. No matter what type of product you need, you can contact us at any time, we will provide high quality products in the fastest and best way to achieve customer satisfaction. In addition, we will provide the best service to our customers. We look forward to establishing long-term business relations with overseas on the basis of mutual benefit in the near future. If you are interested in our products or companies, please feel free to contact us for more details!

Shop RT40 RT50 RT60 BC5 BC10 BC20 CAS154947-66-7 Safe delivery of personalized peptides-Detailed Image 3

Q: How to store it?

A: If it hasn't been opened, just put it in cool dry place, if it is opened, you may put it in cold storage for 2-5 degree condition.

Q: How to order this product?

A: You can click "contact Supplier" , or write an email to my inbox, and send us a inquiry, leave your number if possible, we will contact with you as soon as possible, then we can talk order details.

Q: How about the delivery time?

A: Shipped within 48 hours after payment is received.Small orders are shipped via express door-to-door.The goods arrive in about7-10 days.

Q ： ls cash on delivery ?

A:in most cases,we don't support cash on delivery.

Q: How much is the commodity?

A: As we all know, the price of chemicals is not fixed, but fluctuates with the market.

You need to contact me to get the latest product price, we promise to give you the most favorable price.

Q:About the after-sale service?

A:After purchasing the products from our Company, we have a professional technical team and after-sales team to serve you and solve all your problems in the future.

Shop RT40 RT50 RT60 BC5 BC10 BC20 CAS154947-66-7 Safe delivery of personalized peptides-Detailed Image 4

Why choose us ?

1. Higher quality products (>=9 9 % purity) for most of peptides and raws.

2. Domestic warehouses and stocks: USA

3. Ship worldwide with safe and secure lines: 100% delivery guaranteed. No worry about Customs issues.

4. Many payment options : Bank transfer, bitcoin, USDT,To get a full catalog and price list .

Shop RT40 RT50 RT60 BC5 BC10 BC20 CAS154947-66-7 Safe delivery of personalized peptides-Detailed Image 5

Ite ms	Specifications
Product Name	Lemon Bottle
Specification	10ml*10vials
Package	10 vials/box
Purity	99%
Shelf Life	2 years
Storage	Refrigeration keep dry and away from ligh

Shop RT40 RT50 RT60 BC5 BC10 BC20 CAS154947-66-7 Safe delivery of personalized peptides-Detailed Image 6

We are a professional peptide manufacturing facility that produces high-quality bioactive peptides using advanced equipment, proven processes, and eco-friendly practices.
Advanced Equipment: Fully automated intelligent production lines with end-to-end digital monitoring and control, achieving synthesis precision at the ppm level, ensuring stable and reliable production capacity and quality.
Proven Processes: Decades of technical expertise have led to the development of mature directed enzymatic cleavage and low-temperature purification processes, ensuring consistent product purity of over 98% and supporting custom production at various scales.
Eco-Friendly: We use natural biomass raw materials and are equipped with wastewater recycling and closed-loop exhaust gas treatment systems. Our processes are free of harmful additives and comply with sustainable production standards.
For professional peptide R&D and manufacturing, you can trust us.

Shop RT40 RT50 RT60 BC5 BC10 BC20 CAS154947-66-7 Safe delivery of personalized peptides-Detailed Image 7

Shop RT40 RT50 RT60 BC5 BC10 BC20 CAS154947-66-7 Safe delivery of personalized peptides-Detailed Image 8

Shop RT40 RT50 RT60 BC5 BC10 BC20 CAS154947-66-7 Safe delivery of personalized peptides-Detailed Image 9

Shop RT40 RT50 RT60 BC5 BC10 BC20 CAS154947-66-7 Safe delivery of personalized peptides-Detailed Image 10

Certificates

Basic Info

Product Name:

LL-37

Other Name:

Antibacterial Protein LL-37 (huMan), LL37, CAMP;H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;Antibacterial Protein LL-37 (human);LL-37 (trifluoroacetate salt);[LL-37, 37 aa];Cathelicidin LL 37 (human);LL-37, LL37, CAMP;LL-37 human acetate

CAS No.:

154947-66-7

Molecular Formula:

C205H340N60O53

InChIKeys:

POIUWJQBRNEFGX-XAMSXPGMSA-N

Molecular Weight:

EC Number:

211-519-9

Color/Form:

White to off-white

Categories:

Tonics

Characteristics

Water Solubility:

Soluble to 1 mg/ml in water

Seller Information

Business Type:
Trader

Main Products:
tr

Location:
B27 SHING LEE COMM BLDG 8WING KUT ST CENTRAL HONGKONG

Average lead Time:
1

Total Annual Revenue:
Less than $1 million

Total Employees:
5-10

Year of Establishment:
2026

20 years of production experience in peptide products

Safe and unobstructed shipping channels|High quality guaranteed|

Our company is located in Guangzhou, China. Its production facilities are situated in a modern 5,000-square-meter factory. As a private enterprise, we have over 200 professional employees and are actively expanding our team to support future growth. Over the past two decades, as a comprehensive enterprise integrating research, production, processing and export in the chemical industry, we have performed exceptionally well. Since our establishment, we have always adhered to the principles of "honest management, strict quality control, and customer-oriented service", and have received continuous praise from global customers. Our company is a Chinese manufacturer of peptide products, guaranteeing product quality and effectiveness at affordable prices. We offer reliable and secure shipping channels with discreet delivery to ensure safe and timely arrival.

Inquiry History

1 Inquiries

Country	Product	Purchase Quantity	Date Posted
Indonesia	LL-37	5 MG	Jun 23, 2026

Post an enquiry for this product

More Choices Find All Products for Sale 

Product Name	Grade / Content	Price	Supplier Name	Details
LL37 bulk peptide supplier factory price high purity from china	Pharmaceutical Grade/99	$1/UNIT FOB	Jielu Trading	Inquiry
Peptide White Powder LL-37 99% Purity LL37 Antimicrobial Peptide CAS:154947-66-7	Pharmaceutical Grade/99	$100-130/UNIT FOB		Inquiry
Antibacterial Protein LL-37 (human)	Research and Industrial Grade/98.00		Hangzhou Go Top Peptide Biotech Co.,Ltd.	Inquiry
LL-37, LL37, CAMP, CAP-18, 154947-66-7	Reagent Grade/98	$400-500/G FOB	cellmano peptide	Inquiry
China origin Antimicrobial Peptide Cathelicidin LL-37 (Human) used to kill Gram-negative and Gram-positive bacteria, CAS#154947-66-7	Reagent Grade/98.0		DALIAN HANDOM CHEMICALS CO.,LTD.	Inquiry

RT40 RT50 RT60 BC5 BC10 BC20 CAS154947-66-7 Safe delivery of personalized peptides

Product Description

Seller Information

Inquiry History

20 years of production experience in peptide products

More Choices Find All Products for Sale 

Related Searches